BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A21 (811 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 30 1.6 At5g48230.2 68418.m05959 acetyl-CoA C-acyltransferase, putative ... 30 2.1 At5g48230.1 68418.m05958 acetyl-CoA C-acyltransferase, putative ... 30 2.1 At2g06050.2 68415.m00664 12-oxophytodienoate reductase (OPR3) / ... 29 4.8 At2g06050.1 68415.m00663 12-oxophytodienoate reductase (OPR3) / ... 29 4.8 At5g07270.1 68418.m00829 ankyrin repeat family protein contains ... 28 6.4 At3g61260.1 68416.m06856 DNA-binding family protein / remorin fa... 28 6.4 At3g52680.1 68416.m05803 F-box family protein contains F-box dom... 28 8.4 At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]... 28 8.4 At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR... 28 8.4 At1g61050.1 68414.m06873 alpha 1,4-glycosyltransferase family pr... 28 8.4 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 25 9.4 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 114 PSVCLSPPWQRQPRPTMPPK*PCT 43 PS C SPP + QP+P PP P T Sbjct: 48 PSPCPSPPPKPQPKPVPPPACPPT 71 >At5g48230.2 68418.m05959 acetyl-CoA C-acyltransferase, putative / 3-ketoacyl-CoA thiolase, putative strong similarity to Acetoacetyl-coenzyme A thiolase (E.C. 2.3.1.9) [Raphanus sativus] GI:1542941; contains InterPro accession IPR002155: Thiolase Length = 403 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 509 GLRYGHFHLIGYFLLDGIGDVFLDC 435 G R+GH L+ L DG+ DV+ DC Sbjct: 140 GSRFGHDSLVDGMLKDGLWDVYNDC 164 >At5g48230.1 68418.m05958 acetyl-CoA C-acyltransferase, putative / 3-ketoacyl-CoA thiolase, putative strong similarity to Acetoacetyl-coenzyme A thiolase (E.C. 2.3.1.9) [Raphanus sativus] GI:1542941; contains InterPro accession IPR002155: Thiolase Length = 398 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 509 GLRYGHFHLIGYFLLDGIGDVFLDC 435 G R+GH L+ L DG+ DV+ DC Sbjct: 135 GSRFGHDSLVDGMLKDGLWDVYNDC 159 >At2g06050.2 68415.m00664 12-oxophytodienoate reductase (OPR3) / delayed dehiscence1 (DDE1) nearly identical to DELAYED DEHISCENCE1 [GI:7688991] and to OPR3 [GI:10242314]; contains Pfam profile PF00724:oxidoreductase, FAD/FMN-binding; identical to cDNA OPDA-reductase homolog GI:5059114 Length = 391 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 521 FDGVGLRYGHFHLIGYFLLDGIGD 450 FDG+ + H +LI FL DGI D Sbjct: 180 FDGIEIHGAHGYLIDQFLKDGIND 203 >At2g06050.1 68415.m00663 12-oxophytodienoate reductase (OPR3) / delayed dehiscence1 (DDE1) nearly identical to DELAYED DEHISCENCE1 [GI:7688991] and to OPR3 [GI:10242314]; contains Pfam profile PF00724:oxidoreductase, FAD/FMN-binding; identical to cDNA OPDA-reductase homolog GI:5059114 Length = 391 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 521 FDGVGLRYGHFHLIGYFLLDGIGD 450 FDG+ + H +LI FL DGI D Sbjct: 180 FDGIEIHGAHGYLIDQFLKDGIND 203 >At5g07270.1 68418.m00829 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 513 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 159 LCHRCPFCLVSSLRLPSVCLSPP 91 LC RC L SS +PSV + PP Sbjct: 331 LCVRCALYLCSSSNVPSVTVGPP 353 >At3g61260.1 68416.m06856 DNA-binding family protein / remorin family protein similar to DNA-binding protein gi|601843 [Arabidopsis thaliana], remorin [Solanum tuberosum] GI:1881585; contains Pfam profiles PF03763: Remorin C-terminal region, PF03766: Remorin N-terminal region Length = 212 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 609 EVKVHVDKPYEVKVKVPTPYTVEKKIPYEVKVPFPSPT 722 E K+ ++ KV P P P E+ P P+PT Sbjct: 4 EQKIALESESPAKVTTPAPADTPAPAPAEIPAPAPAPT 41 >At3g52680.1 68416.m05803 F-box family protein contains F-box domain Pfam:PF00646 Length = 456 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 158 YVIDAPFVLFLLFDCLRC 105 YVI+APF+ +LL + LRC Sbjct: 238 YVINAPFLKYLLIEELRC 255 >At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]-like (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to both RPP1 Ws-A and RPP1 Ws-C Length = 872 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 413 KEGACSVYSRETRPLYRREESTL*GESARTSA 508 K G C + RETR L R L ES+R S+ Sbjct: 787 KIGECGILQRETRSLRRSSSPDLSPESSRVSS 818 >At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1194 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 413 KEGACSVYSRETRPLYRREESTL*GESARTSA 508 K G C + RETR L R L ES+R S+ Sbjct: 1155 KIGECGILQRETRSLRRSSSPDLSPESSRVSS 1186 >At1g61050.1 68414.m06873 alpha 1,4-glycosyltransferase family protein / glycosyltransferase sugar-binding DXD motif-containing protein low similarity to alpha-1,4-N-acetylglucosaminyltransferase, Homo sapiens [gi:5726306], Gb3 synthase, Rattus norvegicus [gi:9082162] ; contains Pfam profiles PF04572: Alpha 1,4-glycosyltransferase conserved region, PF04488: Glycosyltransferase sugar-binding region containing DXD motif Length = 435 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -2 Query: 228 ALHSFRDRRSLHRYLRNYVLHKILCHRCPFCLVSSLRL 115 A+H + R ++H+++ H C FC SSL L Sbjct: 397 AVHLWNRESKKLRIEEGSIIHQLMSHSCIFCNSSSLHL 434 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 25.4 bits (53), Expect(2) = 9.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 448 TSPIPSRRKYPMR*KCPYLSPTPSKRKFPLPSRNTS 555 +SP P R + P R + +P +R+ PLP R S Sbjct: 280 SSPPPRRYRSPPRGSPRRIRGSPVRRRSPLPLRRRS 315 Score = 20.6 bits (41), Expect(2) = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 664 PTPLRRKSLTK*KCRSP 714 P PLRR+S + RSP Sbjct: 308 PLPLRRRSPPPRRLRSP 324 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,267,463 Number of Sequences: 28952 Number of extensions: 276083 Number of successful extensions: 798 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1843581600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -