BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A17 (853 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_40494| Best HMM Match : fn3 (HMM E-Value=9.2e-21) 31 1.6 >SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -1 Query: 583 AVHRELSRIHTPFDEVSAHHFSRSLLEGLIFL-TNRIIER 467 ++H + + H +E +SR +LEG+++L TNRI+ R Sbjct: 2 SIHEHIKQ-HGALNESLTRKYSRQILEGILYLHTNRIVHR 40 >SB_40494| Best HMM Match : fn3 (HMM E-Value=9.2e-21) Length = 600 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 353 VKKGGRYQMQVELCNSDGCSSSEGVEIVVADTDGSH 460 V G YQ+ V+ CNS GC S V D G + Sbjct: 275 VLPGTTYQISVQACNSAGCGESSRAVNVTTDKKGDN 310 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,121,113 Number of Sequences: 59808 Number of extensions: 476080 Number of successful extensions: 1311 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -