BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A16 (849 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.7 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 23 3.1 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 22 5.3 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 7.0 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 9.3 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 171 SFLVNMLSKQNPRLFLLPVN 112 SF+V L + NP L+L+PV+ Sbjct: 230 SFVVWPLVENNPTLYLIPVS 249 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 171 SFLVNMLSKQNPRLFLLPVN 112 SF+V L + NP L+L+PV+ Sbjct: 230 SFVVWPLVENNPTLYLIPVS 249 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +3 Query: 435 VNPNVQKIDKFFELEPNKTKQPTGDNASDVVNDVDQQQKIPSEQDLNN 578 +NP VQ ++K+P GD D DQ + + + + N+ Sbjct: 62 LNPAVQGSSLTEGKRSKRSKRPNGDTNGDTSQVDDQNESLEASVNENS 109 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 655 LAWPASVYCFHFS 617 + WPA VYC +S Sbjct: 188 MLWPAWVYCTRYS 200 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 679 IPSD*NVSXPEDRNETDQ 732 + D N+S PED ++ DQ Sbjct: 227 LEDDDNISDPEDDDDKDQ 244 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -3 Query: 409 FAASVGLSATSLGWAAPGRRACVYSTR 329 F + G L W PG+R Y+ + Sbjct: 128 FVKTWGFDGFDLDWEYPGQRGGAYNDK 154 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,528 Number of Sequences: 336 Number of extensions: 3080 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23451794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -