BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A15 (820 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29470.1 68414.m03605 dehydration-responsive protein-related ... 44 2e-04 At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein /... 42 5e-04 At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai... 39 0.005 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 38 0.011 At2g22080.1 68415.m02622 expressed protein 38 0.011 At3g48710.1 68416.m05319 expressed protein putative protein - Ar... 37 0.018 At2g27470.1 68415.m03320 CCAAT-box binding transcription factor ... 37 0.018 At4g34430.4 68417.m04893 DNA-binding family protein contains Pfa... 35 0.075 At4g34430.3 68417.m04892 DNA-binding family protein contains Pfa... 35 0.075 At4g34430.2 68417.m04891 DNA-binding family protein contains Pfa... 35 0.075 At4g34430.1 68417.m04890 DNA-binding family protein contains Pfa... 35 0.075 At1g76770.1 68414.m08934 heat shock protein-related contains sim... 35 0.075 At5g64910.1 68418.m08165 expressed protein ; expression support... 34 0.099 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 34 0.099 At4g26630.1 68417.m03837 expressed protein 34 0.13 At1g56660.1 68414.m06516 expressed protein 34 0.13 At4g05410.1 68417.m00823 transducin family protein / WD-40 repea... 33 0.17 At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)... 33 0.17 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 33 0.17 At4g17910.1 68417.m02669 zinc finger (C3HC4-type RING finger) fa... 33 0.23 At4g08710.1 68417.m01439 hypothetical protein contains Pfam prof... 33 0.23 At1g71470.1 68414.m08259 hypothetical protein 33 0.23 At1g69070.1 68414.m07903 expressed protein 33 0.23 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 33 0.30 At4g15980.1 68417.m02426 pectinesterase family protein contains ... 33 0.30 At3g30450.1 68416.m03852 hypothetical protein similar to At2g049... 33 0.30 At2g12875.1 68415.m01402 hypothetical protein 33 0.30 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 33 0.30 At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptid... 32 0.40 At2g22795.1 68415.m02704 expressed protein 32 0.40 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 32 0.40 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 32 0.53 At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A) co... 32 0.53 At3g42580.1 68416.m04420 Ulp1 protease family protein contains P... 32 0.53 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 32 0.53 At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chlor... 32 0.53 At5g03710.1 68418.m00331 hypothetical protein 31 0.70 At4g07520.1 68417.m01174 hypothetical protein contains Pfam prof... 31 0.70 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 31 0.70 At2g24990.1 68415.m02988 RIO1 family protein similar to extragen... 31 0.92 At1g01680.1 68414.m00086 U-box domain-containing protein 31 0.92 At3g56570.1 68416.m06290 SET domain-containing protein low simil... 31 1.2 At5g23760.1 68418.m02790 heavy-metal-associated domain-containin... 30 1.6 At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein ... 30 1.6 At3g29310.1 68416.m03680 calmodulin-binding protein-related 30 1.6 At3g28770.1 68416.m03591 expressed protein 30 1.6 At3g28510.1 68416.m03561 AAA-type ATPase family protein contains... 30 1.6 At3g62800.2 68416.m07056 double-stranded RNA-binding domain (DsR... 30 2.1 At3g62800.1 68416.m07055 double-stranded RNA-binding domain (DsR... 30 2.1 At3g57930.1 68416.m06457 expressed protein 30 2.1 At3g01160.1 68416.m00020 expressed protein 30 2.1 At1g17690.1 68414.m02190 expressed protein 30 2.1 At5g63550.1 68418.m07976 expressed protein 29 2.8 At4g28080.1 68417.m04027 expressed protein 29 2.8 At3g49990.1 68416.m05466 expressed protein 29 2.8 At2g30690.1 68415.m03742 expressed protein contains Pfam profile... 29 2.8 At5g53440.1 68418.m06641 expressed protein 29 3.7 At3g49470.1 68416.m05407 nascent polypeptide-associated complex ... 29 3.7 At1g67580.1 68414.m07699 protein kinase family protein contains ... 29 3.7 At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar ... 29 4.9 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 4.9 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 4.9 At5g23420.1 68418.m02747 high mobility group (HMG1/2) family pro... 29 4.9 At5g16500.1 68418.m01928 protein kinase family protein contains ... 29 4.9 At5g10660.1 68418.m01234 calmodulin-binding protein-related cont... 29 4.9 At4g29680.1 68417.m04228 type I phosphodiesterase/nucleotide pyr... 29 4.9 At2g25670.2 68415.m03077 expressed protein 29 4.9 At2g25670.1 68415.m03076 expressed protein 29 4.9 At1g18950.1 68414.m02358 aminoacyl-tRNA synthetase family contai... 29 4.9 At5g58590.1 68418.m07342 Ran-binding protein 1, putative / RanBP... 28 6.5 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 28 6.5 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 28 6.5 At5g02390.1 68418.m00162 expressed protein ; expression supporte... 28 6.5 At3g49540.1 68416.m05414 expressed protein 28 6.5 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 28 6.5 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 28 6.5 At1g76820.1 68414.m08939 expressed protein 28 6.5 At1g29000.1 68414.m03546 heavy-metal-associated domain-containin... 28 6.5 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 28 6.5 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 28 8.6 At5g62750.1 68418.m07877 expressed protein predicted proteins, C... 28 8.6 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 28 8.6 At5g40450.1 68418.m04905 expressed protein 28 8.6 At3g14670.1 68416.m01856 hypothetical protein 28 8.6 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 28 8.6 At1g65440.1 68414.m07424 glycine-rich protein 28 8.6 At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam ... 28 8.6 At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein /... 28 8.6 At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein /... 28 8.6 At1g15940.1 68414.m01913 expressed protein similar To androgen-i... 28 8.6 At1g09210.1 68414.m01028 calreticulin 2 (CRT2) identical to SP|Q... 28 8.6 At1g01490.1 68414.m00065 heavy-metal-associated domain-containin... 28 8.6 >At1g29470.1 68414.m03605 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 43.6 bits (98), Expect = 2e-04 Identities = 36/119 (30%), Positives = 47/119 (39%), Gaps = 2/119 (1%) Frame = +3 Query: 6 EKKTKRGRKAAGDT-NGQDENGKIEETAPKKGRKKN-VEEPPVENKSTDEPSVEDEVAVS 179 E+K + GD NG E E+ K ++K +EE ENKS D E+ S Sbjct: 116 ERKEFDDKNGDGDRKNGDGEKDTESESDETKQKEKTQLEESSEENKSEDSNGTEENAGES 175 Query: 180 EENNPSEDGSETNGHIEEEQVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVEDK 356 EEN +E SE N EE + E TG G Q +E + E K Sbjct: 176 EEN--TEKKSEENAGETEESTEKSKDVFPAGDQAEITKESSTGSGAWSTQLVESQNEKK 232 >At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus}; similar to GI:807956 from [Saccharomyces cerevisiae]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 573 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEE---TAPKKGRKKNVEEPPVENKSTDEPSVEDEVAV 176 E++TK K K+EE P +K+ E PVE KS ++P + EV Sbjct: 131 EEETKEEEKTEEKKEETTTEVKVEEEKPAVPAAEEEKSSEAAPVETKSEEKPEEKAEVTT 190 Query: 177 SEENNPSEDGSETNGHIEEEQV 242 + ++ EDG++T IEE V Sbjct: 191 EKASSAEEDGTKTVEAIEESIV 212 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +3 Query: 123 PVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 239 PV+ + T+E E+E E+ ++ + T +EEE+ Sbjct: 119 PVKEEKTEEKKTEEETKEEEKTEEKKEETTTEVKVEEEK 157 >At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains Pfam profiles PF00270:DEAD/DEAH box helicase and PF00271: Helicase conserved C-terminal domain; identical to cDNA RH27 helicase, partial GI:4033334 Length = 633 Score = 38.7 bits (86), Expect = 0.005 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 4/83 (4%) Frame = +3 Query: 6 EKKTKRGRKAAGDTN-GQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSE 182 +KK K+ K GDT+ G+DE + E PKK +KKN ++ + DE EDEV E Sbjct: 60 KKKKKKKNKKRGDTDDGEDE--AVAEEEPKKKKKKN-KKLQQRGDTNDE---EDEVIAEE 113 Query: 183 E---NNPSEDGSETNGHIEEEQV 242 E + +T EEE+V Sbjct: 114 EEPKKKKKKQRKDTEAKSEEEEV 136 Score = 37.9 bits (84), Expect = 0.008 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +3 Query: 6 EKKTKRGRKAA--GDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVS 179 +KK K+ +K GDTN +++ EE PKK +KK + K T+ S E+EV Sbjct: 87 KKKKKKNKKLQQRGDTNDEEDEVIAEEEEPKKKKKK-------QRKDTEAKSEEEEVEDK 139 Query: 180 EENNPSEDGS 209 EE E+ S Sbjct: 140 EEEKKLEETS 149 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/105 (20%), Positives = 47/105 (44%) Frame = +3 Query: 42 DTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNG 221 D + ++ N I+E KK +KKN + ++ + + E+ ++N + +TN Sbjct: 45 DGDAKENNALIDEEPKKKKKKKNKKRGDTDDGEDEAVAEEEPKKKKKKNKKLQQRGDTND 104 Query: 222 HIEEEQVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVEDK 356 EE++V + + + + ++E+ED+ E+K Sbjct: 105 --EEDEVIA----EEEEPKKKKKKQRKDTEAKSEEEEVEDKEEEK 143 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 37.5 bits (83), Expect = 0.011 Identities = 28/93 (30%), Positives = 40/93 (43%) Frame = +3 Query: 75 EETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSGR 254 EE +P +GR K+ E+ E+ DE S+E+ E+G G E++ SGR Sbjct: 536 EEKSPARGRGKDSEDEYEEDAEEDEEERGKSNRYSDEDEEEEEG----GRAEKDHRGSGR 591 Query: 255 GRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVED 353 R P PR + K I+D ED Sbjct: 592 KRKGIESDEEESP-PRKAPTHRRKAVIDDSDED 623 >At2g22080.1 68415.m02622 expressed protein Length = 177 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/68 (26%), Positives = 35/68 (51%) Frame = +3 Query: 36 AGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSET 215 +GD G+DE G ++ K+ +K V +P + ++ D +DE + N+ +D + Sbjct: 71 SGDDGGEDEEGSADDAEGKETKKGPVSDPDLNGEAGDN---DDEPEGDDGNDDEDDDNHE 127 Query: 216 NGHIEEEQ 239 N +EE+ Sbjct: 128 NDDEDEEE 135 Score = 28.7 bits (61), Expect = 4.9 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEEN 188 K+TK+G + D NG E G ++ + ++ EN DE EDE E Sbjct: 89 KETKKGPVSDPDLNG--EAGDNDDEPEGDDGNDDEDDDNHENDDEDEEEDEDENDDGGEE 146 Query: 189 NPSEDGSETNGHIEEEQ 239 + ED EE++ Sbjct: 147 DDDEDAEVEEEEEEEDE 163 >At3g48710.1 68416.m05319 expressed protein putative protein - Arabidopsis thaliana, EMBL:AL078465.1 Length = 462 Score = 36.7 bits (81), Expect = 0.018 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 7/73 (9%) Frame = +3 Query: 6 EKKTKRGRKAAGD--TNGQDEN--GKIEETAPKKGRKKNVE---EPPVENKSTDEPSVED 164 EK+TK+ +K+ T+G+ + K A K+ + E E V ++ T++ + ED Sbjct: 211 EKETKKRKKSTSKNVTSGESSHVPAKRRRQAKKQEQPTETEGNGESDVGSEGTNDSNGED 270 Query: 165 EVAVSEENNPSED 203 +VA EENN SED Sbjct: 271 DVAPEEENNKSED 283 >At2g27470.1 68415.m03320 CCAAT-box binding transcription factor subunit HAP3-related contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to polymerase epsilon p17 subunit (DNA polymerase epsilon subunit 3) (YB-like protein 1) (YBL1) (NF-YB-like protein) (SP:Q9JKP7) [Mus musculus]; Length = 275 Score = 36.7 bits (81), Expect = 0.018 Identities = 28/123 (22%), Positives = 49/123 (39%), Gaps = 5/123 (4%) Frame = +3 Query: 3 LEKKTKRGRKAAGDTNGQDENGKIEE-----TAPKKGRKKNVEEPPVENKSTDEPSVEDE 167 ++++TKR + + N ++ENG EE + +N EE + ++ DE + E+ Sbjct: 153 IDEETKRNDEETENDNTEEENGNDEEDENGNDEEDENDDENTEENGNDEENDDENTEENG 212 Query: 168 VAVSEENNPSEDGSETNGHIEEEQVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEV 347 E E+ E NG+ EE E G +E+E + Sbjct: 213 NDEENEKEDEENSMEENGNESEESGNEDHSMEENGSGVGEDNENEDGSVSGSGEEVESDE 272 Query: 348 EDK 356 ED+ Sbjct: 273 EDE 275 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 6/83 (7%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIEETA------PKKGRKKNVEEPPVENKSTDEPSVEDEV 170 KK G+KA G +++ PK+ +K+ EEP + K + +++E Sbjct: 99 KKKNAGKKAGAAAASYPAGGAALKSSSGTASKPKETKKRKQEEPSTQ-KGARKSKIDEET 157 Query: 171 AVSEENNPSEDGSETNGHIEEEQ 239 ++E +++ E NG+ EE++ Sbjct: 158 KRNDEETENDNTEEENGNDEEDE 180 >At4g34430.4 68417.m04893 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 986 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +3 Query: 54 QDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 +D+N +++ + KK V+E K EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETM-KEVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 234 EQ 239 EQ Sbjct: 494 EQ 495 >At4g34430.3 68417.m04892 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 983 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +3 Query: 54 QDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 +D+N +++ + KK V+E K EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETM-KEVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 234 EQ 239 EQ Sbjct: 494 EQ 495 >At4g34430.2 68417.m04891 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 985 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +3 Query: 54 QDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 +D+N +++ + KK V+E K EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETM-KEVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 234 EQ 239 EQ Sbjct: 494 EQ 495 >At4g34430.1 68417.m04890 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 985 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +3 Query: 54 QDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 +D+N +++ + KK V+E K EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETM-KEVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 234 EQ 239 EQ Sbjct: 494 EQ 495 >At1g76770.1 68414.m08934 heat shock protein-related contains similarity to 17.9 kDa heat-shock protein [Helianthus annuus] gi|11990130|emb|CAB55634 Length = 244 Score = 34.7 bits (76), Expect = 0.075 Identities = 24/84 (28%), Positives = 35/84 (41%) Frame = +3 Query: 69 KIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPS 248 KIEE ++ K+ + E E K+ E +++E EEN E+ E EEE V Sbjct: 136 KIEEEDEEEEMKEPIVEEKTEEKTEPEEEIKEETKPEEEN---EEAEEPQREEEEEVVEE 192 Query: 249 GRGRXXXXXXXXXXPEPRTGRGRK 320 G +PR R +K Sbjct: 193 GTRDHEGKKEEEIEDKPRKKRRKK 216 >At5g64910.1 68418.m08165 expressed protein ; expression supported by MPSS Length = 487 Score = 34.3 bits (75), Expect = 0.099 Identities = 27/100 (27%), Positives = 39/100 (39%) Frame = +3 Query: 57 DENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 236 +E GK EE A + E VE+K+ +E E+E +E E E EE Sbjct: 62 EEEGKNEEEA---NENQEEEAAKVESKAAEEGGNEEEAKEDKEEEKEEAAREDKEEEEEA 118 Query: 237 QVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVEDK 356 P EP+ RG++ K+ + E E K Sbjct: 119 VKPDESASQKEEAKGASSSEPQLRRGKR-KRGTKTEAEKK 157 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 34.3 bits (75), Expect = 0.099 Identities = 24/72 (33%), Positives = 34/72 (47%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 EK T G+ + +DENG+ EE + N EE E+ S DE + E E+ Sbjct: 259 EKTTASEENGKGEKSMKDENGQQEEHTTAEEESGNKEE---ESTSKDENMEQQEERKDEK 315 Query: 186 NNPSEDGSETNG 221 + E GSE +G Sbjct: 316 KH--EQGSEASG 325 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 33.9 bits (74), Expect = 0.13 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSV-EDEVAVSE 182 E+ TK +K+ ++ + E K EE ++ + + EE E P EDE Sbjct: 506 EEATKVVKKSLAHSDDESEEEKEEEEKQEEEKAEEKEEKKEEENENGIPDKSEDEAPQPS 565 Query: 183 ENNPSEDGSETNGHIEEEQVPSGRG 257 E SE+ E+ H EEE RG Sbjct: 566 E---SEEKDESEEHSEEETTKKKRG 587 Score = 30.7 bits (66), Expect = 1.2 Identities = 29/81 (35%), Positives = 37/81 (45%), Gaps = 11/81 (13%) Frame = +3 Query: 39 GDTNGQDENGKIEETAPKKGRK-KNVEEPPVENKSTDEPSVEDEVAVSEENNPSE----- 200 GD N Q EN + +E K+ K K VE E DE VEDE SE+ N +E Sbjct: 203 GDENKQVENVEGKEKEDKEENKTKEVEAAKAE---VDESKVEDEKEGSEDENDNEKVESK 259 Query: 201 -----DGSETNGHIEEEQVPS 248 + ETN E+E+ S Sbjct: 260 DAKEDEKEETNDDKEDEKEES 280 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 33.9 bits (74), Expect = 0.13 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVE-NKSTDEPSVEDEVAVSE 182 EK+ K+G++ + +++ GK KK +K+ E P E NK D+ ++V+ + Sbjct: 112 EKEHKKGKEKKHEELEEEKEGK-----KKKNKKEKDESGPEEKNKKADKEKKHEDVSQEK 166 Query: 183 ENNPSEDGSETNGHIEEE 236 E EDG + ++E Sbjct: 167 EELEEEDGKKNKKKEKDE 184 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 4/76 (5%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV----ENKSTDEPSVEDEVA 173 E T+ +K+ + +E K ++ KK +KK+ +EP + E K D V+ E + Sbjct: 408 EDDTEEKKKSKVEGGESEEGKKKKKKDKKKNKKKDTKEPKMTEDEEEKKDDSKDVKIEGS 467 Query: 174 VSEENNPSEDGSETNG 221 ++E +D + G Sbjct: 468 KAKEEKKDKDVKKKKG 483 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 E+K K+ K + E ++EE KK +KK +E E K +P E + EE Sbjct: 147 EEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKK-KKPKKEKK--QKEE 203 Query: 186 NNPSED 203 + +ED Sbjct: 204 SKSNED 209 >At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695; Vegetatible incompatibility protein HET-E-1 (SP:Q00808) [Podospora anserina] Length = 504 Score = 33.5 bits (73), Expect = 0.17 Identities = 21/76 (27%), Positives = 33/76 (43%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEEN 188 +K K G G G +E E PKK RK + ++ +E SV+ + + Sbjct: 6 EKKKGGSFKRGGKKGSNERDPFFEEEPKKRRKVSYDDDDIE-------SVDSDAEENGFT 58 Query: 189 NPSEDGSETNGHIEEE 236 EDG +G +E+E Sbjct: 59 GGDEDGRRVDGEVEDE 74 >At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13) similar to RNA helicase GB:CAA09204 from [Arabidopsis thaliana]; identical to cDNA DEAD box RNA helicase, RH13 GI:3776002 Length = 832 Score = 33.5 bits (73), Expect = 0.17 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +3 Query: 24 GRKAAGDTNGQDENGKI--EETAPKKGRK-KNVEEPPVENKSTDEPSVEDEVAVSEENNP 194 G +A D G+D+ EET KK +K K +E E K + + + + + Sbjct: 109 GEEAEEDGEGRDDEDDEDDEETRKKKEKKAKRNKEKKKEKKKKKQKKINEAAKNQDASAV 168 Query: 195 SEDGSET-NGHIEEEQVP 245 S DG +T +EEE++P Sbjct: 169 SCDGDDTVEEQVEEEEIP 186 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 33.5 bits (73), Expect = 0.17 Identities = 31/123 (25%), Positives = 52/123 (42%), Gaps = 6/123 (4%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKG---RKKNVEEPPVENKSTDEPSVEDEVAV 176 E++T+R ++ + ++E K EE K+ RKK EE K +E E+E+A Sbjct: 472 EEETERKKREEEEARKREEERKREEEEAKRREEERKKREEEAEQARKREEEREKEEEMAK 531 Query: 177 S-EENNPSEDGSETNGHIEEEQVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIE--DEV 347 EE ++ E EEQ R E + R+ +++ + +EV Sbjct: 532 KREEERQRKEREEVERKRREEQERKRREEEARKREEERKREEEMAKRREQERQRKEREEV 591 Query: 348 EDK 356 E K Sbjct: 592 ERK 594 >At4g17910.1 68417.m02669 zinc finger (C3HC4-type RING finger) family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam domains PF01535: PPR repeat and PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1208 Score = 33.1 bits (72), Expect = 0.23 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +3 Query: 60 ENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 236 E K E+ ++ +N+ EP EN S + +VE + E NP E+ E G EEE Sbjct: 459 EENKFEDENCEQESPENLNEPEEENISEEGDNVEPMQSQGMEENPEEE--EKEGEEEEE 515 >At4g08710.1 68417.m01439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 715 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +3 Query: 75 EETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 239 +ETAP + + ++ E EN +E E++ +E E+G E EEE+ Sbjct: 62 KETAPTRTEEPSLTEQDPENVEEEESEEEEKEEEEKEEEEEEEGEEEEEEEEEEE 116 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = +3 Query: 60 ENGKIEETAP--KKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 E +ETAP K+ EEP + + + E+ +E E+ E G EE Sbjct: 50 ETAPTKETAPATKETAPTRTEEPSLTEQDPENVEEEESEEEEKEEEEKEEEEEEEGEEEE 109 Query: 234 EQ 239 E+ Sbjct: 110 EE 111 >At1g71470.1 68414.m08259 hypothetical protein Length = 131 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 87 PK-KGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 PK + ++ + + V N S D+ S+EDE + SE NN +E NG +E Sbjct: 10 PKPESSEEELSDSQVSNSSEDDDSMEDEPSDSENNNGVVTETEANGIKDE 59 >At1g69070.1 68414.m07903 expressed protein Length = 901 Score = 33.1 bits (72), Expect = 0.23 Identities = 26/78 (33%), Positives = 42/78 (53%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 E+ TKR +GD G ++ +EE PK+G +V E E+ + S EDE + SEE Sbjct: 314 EESTKRLTVISGDDLG--DSFSVEEDKPKRGWIDDVLER--EDNVDNSESDEDEDSESEE 369 Query: 186 NNPSEDGSETNGHIEEEQ 239 +D E++G E+++ Sbjct: 370 E--EDDDGESDGGDEKQR 385 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 32.7 bits (71), Expect = 0.30 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDE---VAV 176 E+ T+ +K+ ++ + E K ++ +K ++ VEE EN++ EDE ++ Sbjct: 512 EEATRTNKKSVAHSDDESEEEKEDDEEEEK--EQEVEEEEEENENGIPDKSEDEAPQLSE 569 Query: 177 SEENNPSEDGSE 212 SEEN SE+ SE Sbjct: 570 SEENVESEEESE 581 >At4g15980.1 68417.m02426 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 701 Score = 32.7 bits (71), Expect = 0.30 Identities = 20/81 (24%), Positives = 29/81 (35%) Frame = +3 Query: 114 EEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSGRGRXXXXXXXXXXP 293 + PP E+ S D PS D S EN P + SE P + P Sbjct: 238 DSPPNEDSSDDSPSTVD----SSENQPVDSSSENQSSDSSNNRPLDSSKNQQMESSEDTP 293 Query: 294 EPRTGRGRKPKQEIEDEVEDK 356 + G +P + D++ K Sbjct: 294 KKSAFSGNQPLDDSSDKLPQK 314 >At3g30450.1 68416.m03852 hypothetical protein similar to At2g04970, At2g15200, At1g32830, At2g14140, At4g03990, At5g34895, At3g47270, At2g02200 Length = 800 Score = 32.7 bits (71), Expect = 0.30 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 4/84 (4%) Frame = +3 Query: 6 EKKTKR-GRKAAGDTNGQDENGKIEETAPKKGR-KKNVEEPPVENKSTDEPSVEDEVAVS 179 +++TKR GRK + Q+E GK EE + R + E+ + + +E E+E Sbjct: 373 KRRTKRRGRKKEQEEEKQEEEGKEEELEKVEYRGDEGTEKQEIPKQGDEEMEGEEEKQEE 432 Query: 180 EENNPSEDGSETNGH--IEEEQVP 245 E E+ E G E++++P Sbjct: 433 EGKEEEEEKVEYRGDEGTEKQEIP 456 >At2g12875.1 68415.m01402 hypothetical protein Length = 325 Score = 32.7 bits (71), Expect = 0.30 Identities = 22/80 (27%), Positives = 32/80 (40%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEEN 188 K +G KA + E K E + KN EE K E S E+E E+ Sbjct: 85 KLIDKGTKATTEEPSSTEQNKAIEAVKEDKYDKNEEEK--SEKDEQEKSEEEESEEEEKE 142 Query: 189 NPSEDGSETNGHIEEEQVPS 248 ++DG E++ + PS Sbjct: 143 EGNDDGEESSNDSTTTEEPS 162 Score = 31.1 bits (67), Expect = 0.92 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 30 KAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDG 206 K+ D + E + EE ++G EE ++ +T+EPS +E + SE+N E G Sbjct: 122 KSEKDEQEKSEEEESEEEEKEEGNDDG-EESSNDSTTTEEPSSTEEPSSSEQNKAIEGG 179 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +3 Query: 72 IEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 251 +EE K ++ E+ E KS +E S E+E E+ E+G++ G I ++ Sbjct: 195 VEEEKSYKNEEEKSEKDE-EEKSEEEESEEEEKEEEEKEEEKEEGNDCWGRISPKRPSRA 253 Query: 252 R 254 R Sbjct: 254 R 254 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVED-EVAVSEE 185 K+ G + QDE + P++ +++ EE P E+ D E+ +VA +E+ Sbjct: 1140 KEVTVGEAVNMEVENQDEEDDDGDDDPEEDPEEDPEEDPEEDPEEDPEECEEMDVANTEQ 1199 Query: 186 NNPSEDGSETNGHIEE 233 P+E+ + ++E+ Sbjct: 1200 EEPAEEPQKKEENLEK 1215 >At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptidyl-prolyl cis-trans isomerase-related immunophilin FKBP46 - Spodoptera frugiperda (fall armyworm),PIR2:A55320 Length = 477 Score = 32.3 bits (70), Expect = 0.40 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +3 Query: 18 KRGRKAAGDTNGQDENGKIEETAPKKGRKK--NVEEPPVENKSTDEPSVEDEVAVSEENN 191 KR KAA +GQ+ K ++ +K +KK NV T + +++ N Sbjct: 247 KRKAKAAEQDDGQESANKSKKKKNQKEKKKGENVLNEEAGQVQTGNVLKKQDISQISSNT 306 Query: 192 PSEDGSETNGHIEEEQVP 245 ++DG+ N E + P Sbjct: 307 KAQDGTANNAMSESSKTP 324 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 32.3 bits (70), Expect = 0.40 Identities = 21/82 (25%), Positives = 35/82 (42%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 E+ K G + + + + ENG EE + VEE +N T+E + SE Sbjct: 197 EENEKSGTEES-EVEERKENGGTEENEKSGSEESEVEEKK-DNGGTEESREKSGTEESEV 254 Query: 186 NNPSEDGSETNGHIEEEQVPSG 251 ++GS +EE++ G Sbjct: 255 EEKKDNGSSEESEVEEKKENRG 276 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 EKK G + + + +G +E+ ++EE +++ E EN+ DE E + E+ Sbjct: 233 EKKDNGGTEESREKSGTEES-EVEEKKDNGSSEESEVEEKKENRGIDESEESKEKDIDEK 291 Query: 186 NNPSEDGSETN 218 N E+ E N Sbjct: 292 AN-IEEARENN 301 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/71 (26%), Positives = 31/71 (43%) Frame = +3 Query: 27 RKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDG 206 +++ G + +D N +IEE G VEE VE K + E+ E + E+ Sbjct: 113 KESEGIVSNEDSNSEIEEKKDSGG----VEESEVEEKRDNGGGTEENEKSGTEESEVEER 168 Query: 207 SETNGHIEEEQ 239 + G E E+ Sbjct: 169 KDNGGTEENEK 179 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 32.3 bits (70), Expect = 0.40 Identities = 29/121 (23%), Positives = 44/121 (36%), Gaps = 5/121 (4%) Frame = +3 Query: 12 KTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTD---EPSVEDEVAVSE 182 K + G + + D+ +EE K P V+N+ D E +EV + Sbjct: 4638 KPEEGNDENVEQDDFDDTDNLEEKIQTKEEALGGLTPDVDNEQIDDDMEMDKTEEVEKED 4697 Query: 183 ENNPSEDGSETNGHIEEEQVPSGRGRXXXXXXXXXXPEPRTGRGRK--PKQEIEDEVEDK 356 N E SE H EE + + E R G +K P ++E E E + Sbjct: 4698 ANQQEEPCSEDQKHPEEGENDQEETQEPSEENMEAEAEDRCGSPQKEEPGNDLEQEPETE 4757 Query: 357 P 359 P Sbjct: 4758 P 4758 Score = 30.7 bits (66), Expect = 1.2 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVE--EPPVENKSTDEPSVEDEVAVS 179 E K G + NG + G E A +K K+ E E + K+ PS+ D+ S Sbjct: 4555 EDKEDEGSEDEPLDNGIGDVGSDAEKADEKPWNKDEEDEEENMNEKNESGPSIVDKDTRS 4614 Query: 180 EENNPSEDGSETNGHIEE 233 E +DG ET EE Sbjct: 4615 RELRAKDDGVETADEPEE 4632 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 31.9 bits (69), Expect = 0.53 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 6/87 (6%) Frame = +3 Query: 6 EKKTKRGR---KAAG-DTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVA 173 EKK K+G+ KA + G++EN + KK RK+ E E +E E + Sbjct: 697 EKKDKKGKAKQKAEEIEVTGKEENETDKHGKMKKERKRKKSESKKEGGEGEETQKEANES 756 Query: 174 VSEE--NNPSEDGSETNGHIEEEQVPS 248 +E SE +++G E ++ PS Sbjct: 757 TKKERKRKKSESKKQSDGEEETQKEPS 783 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIE-ETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 + TK+ RK + + +G+ E + P + KK + E+K E E+E Sbjct: 755 ESTKKERKRKKSESKKQSDGEEETQKEPSESTKKERKRKNPESKKKAEAVEEEETRKESV 814 Query: 186 NNPSEDGSETNGHIEEEQVPS 248 + ++ +EE+VP+ Sbjct: 815 ESTKKERKRKKPKHDEEEVPN 835 >At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A) contains Pfam domain, PF00096: Zinc finger, C2H2 type; identical to cDNA putative histone deacetylase (HD2A) GI:11066134 Length = 245 Score = 31.9 bits (69), Expect = 0.53 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +3 Query: 57 DENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 236 +E + EE P K V +P + +P+V+DE S+ + ED S+ EEE Sbjct: 104 EEEEEEEEEVPAGNAAKAVAKPKAKPAEV-KPAVDDEEDESDSDGMDEDDSDGEDSEEEE 162 Query: 237 QVP 245 P Sbjct: 163 PTP 165 >At3g42580.1 68416.m04420 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 903 Score = 31.9 bits (69), Expect = 0.53 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Frame = +3 Query: 15 TKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDE--VAVSEEN 188 T + A D G E + PK ++N EPP + +EP V DE VA +E+N Sbjct: 504 TSTHQDVAKDVVGNTEESVVAAELPKM--EENSMEPP--HSPQNEPRVRDEIDVAHTEDN 559 Query: 189 NPSEDGSETNGH--IEEEQVPS 248 +++ + +G ++E Q PS Sbjct: 560 KRNDEPTSGDGEEVLKEAQSPS 581 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 31.9 bits (69), Expect = 0.53 Identities = 21/75 (28%), Positives = 32/75 (42%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 EK K G K GQ E + E+ K+G K E E + S+E + + E+ Sbjct: 167 EKVNKEGEKTEAGKEGQTEIAEAEKE--KEGEKAEAENKEAEVVRDKKESMEVDTSELEK 224 Query: 186 NNPSEDGSETNGHIE 230 S +G+E +E Sbjct: 225 KAGSGEGAEEPSKVE 239 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +3 Query: 75 EETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSGR 254 E + KK EN++ + + E AV+EE + +TN +E QV + Sbjct: 317 ENDTQESDEKKTEAAANKENETQESDVKKTEAAVAEEKSNDMKAEDTNRSLEANQVQQQQ 376 Query: 255 G 257 G Sbjct: 377 G 377 >At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chloroplast, putative / Mg-protoporphyrin IX chelatase, putative (CHLD) similar to Mg-chelatase SP|O24133 from Nicotiana tabacum, GB:AF014399 GI:2318116 from [Pisum sativum] Length = 760 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +3 Query: 72 IEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVP 245 ++ET P++ + PP +N + E E+E EE E E +++Q+P Sbjct: 400 LDETPPEQQNQPPPPPPPPQNSESGEEENEEE---QEEEEEDESNEENENEQQQDQIP 454 >At5g03710.1 68418.m00331 hypothetical protein Length = 81 Score = 31.5 bits (68), Expect = 0.70 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +3 Query: 51 GQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIE 230 G++E + EE ++ ++ EE E + +E E+E EE E+ E E Sbjct: 5 GEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 64 Query: 231 EE 236 EE Sbjct: 65 EE 66 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = +3 Query: 66 GKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 239 G+ EE ++ ++ EE E + +E E+E EE E+ E EEE+ Sbjct: 5 GEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 62 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +3 Query: 75 EETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSGR 254 EE ++ ++ EE E + +E E+E EE E+ E EEE+ R Sbjct: 9 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDR 68 Query: 255 GR 260 R Sbjct: 69 ER 70 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +3 Query: 57 DENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 236 +E + EE ++ ++ EE E + +E E+E EE E+ E EEE Sbjct: 6 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 65 Query: 237 Q 239 + Sbjct: 66 E 66 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/62 (24%), Positives = 28/62 (45%) Frame = +3 Query: 54 QDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 ++E + EE ++ ++ EE E + +E E+E EE E+ E EE Sbjct: 7 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 66 Query: 234 EQ 239 ++ Sbjct: 67 DR 68 >At4g07520.1 68417.m01174 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 734 Score = 31.5 bits (68), Expect = 0.70 Identities = 25/100 (25%), Positives = 36/100 (36%) Frame = +3 Query: 60 ENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 239 E K E+ ++ KN+ EP E S + E + E NP E+ E G EEE Sbjct: 35 EENKFEDENCEQEPPKNLHEPEEEKISEEVDDEEPMQSQGMEENPEEE--EKEGEEEEES 92 Query: 240 VPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVEDKP 359 P+ G + + E D+ E P Sbjct: 93 EEGDDVEPMQSQGMEENPKEEEKEGEEEESEEIDDDEPMP 132 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 31.5 bits (68), Expect = 0.70 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPS-VEDEVAVSE 182 +K KAA ++ DE+ EE+ +K +K + + S+DE S E++ + E Sbjct: 203 KKAAPAAAKAASSSDSSDEDSD-EESEDEKPAQKKADTKASKKSSSDESSESEEDESEDE 261 Query: 183 ENNPSEDGSE 212 E P + S+ Sbjct: 262 EETPKKKSSD 271 >At2g24990.1 68415.m02988 RIO1 family protein similar to extragenic suppressor of the bimD6 mutation (SUDD) [Emericella nidulans] GI:2338556, RIO1 [Saccharomyces cerevisiae] GI:1359602; contains Pfam profile PF01163: RIO1 family Length = 537 Score = 31.1 bits (67), Expect = 0.92 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +3 Query: 45 TNGQDENGKIEETAPK-KGRKKNVEEPPVE--NKSTDEPSVEDEVAVSEENNPSEDGSET 215 T+GQD + +T K +EE +E ++ +E E+E SEE + E+ E Sbjct: 431 TSGQDTGDMLYQTITGLKDALPKIEEQKIEVNDEEKEEEGEEEEDGESEEGSEEEESEEE 490 Query: 216 NGHIEEE 236 GH +++ Sbjct: 491 LGHEDKK 497 >At1g01680.1 68414.m00086 U-box domain-containing protein Length = 308 Score = 31.1 bits (67), Expect = 0.92 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 78 ETAPKKGRKKNVEEPPVENKSTDEPSVED 164 E +PKKGRK+ +E+ N+S ++P +ED Sbjct: 209 EESPKKGRKETIEKSK-SNESDEDPRLED 236 >At3g56570.1 68416.m06290 SET domain-containing protein low similarity to SP|Q43088 Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N- methyltransferase, chloroplast precursor (EC 2.1.1.127) {Pisum sativum}; contains Pfam profile PF00856: SET domain Length = 531 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = +3 Query: 33 AAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSE 212 AA +T +DE ++P++ + EE P EN + E+E EE E+G E Sbjct: 222 AANETTDEDEPSSKISSSPEQ----SFEEVPGENTDDEAKEEEEEEEEEEEGEEEEEGEE 277 >At5g23760.1 68418.m02790 heavy-metal-associated domain-containing protein Pfam profile PF00403: Heavy-metal-associated domain Length = 103 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 540 PKKKETKSRKNQGKKVAAKEETDDAVREDEP 632 P K+E K K + KK KEE + +E+EP Sbjct: 71 PAKEEKKEEKKEEKKEEKKEEKKEEQKEEEP 101 >At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 287 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +3 Query: 78 ETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 242 + APK K+ + P E+ + +D+ SEE++ +D SE +G EEE+V Sbjct: 108 KAAPKSAAKQVNFQLPNEDVKAKQ---DDDADGSEEDSSDDDDSENSGDEEEEKV 159 >At3g29310.1 68416.m03680 calmodulin-binding protein-related Length = 551 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +3 Query: 63 NGKIEETAPKKGRKKNVEE---PPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 +G E +KG VEE P EN+S +E E++ SE S +GSE + + + Sbjct: 472 SGSNEGNGEEKGNVNEVEEIKYVPKENESFEEE--EEKETDSENEVSSSEGSEGDKRVTK 529 Query: 234 EQVPSGRG 257 ++V +G Sbjct: 530 KEVQHQKG 537 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/79 (20%), Positives = 36/79 (45%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 EKK K+ + +EN K +ET +K + K+ ++ + + S+E E +E Sbjct: 1202 EKKLKKNEEDRKKQTSVEENKKQKETKKEKNKPKDDKKNTTKQSGGKKESMESESKEAEN 1261 Query: 186 NNPSEDGSETNGHIEEEQV 242 S+ ++ + + ++ Sbjct: 1262 QQKSQATTQADSDESKNEI 1280 >At3g28510.1 68416.m03561 AAA-type ATPase family protein contains Pfam profile: PF00004 ATPase family Length = 530 Score = 30.3 bits (65), Expect = 1.6 Identities = 23/74 (31%), Positives = 38/74 (51%) Frame = +3 Query: 3 LEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSE 182 LE++ ++ RK A + +E K E+ A K K EE + K T+E +++V E Sbjct: 457 LEEEKEKARKLAEE----EEKKKAEKEAKKM---KKAEEAEEKKKKTEEDEKKEKVKAKE 509 Query: 183 ENNPSEDGSETNGH 224 EN + S+ NG+ Sbjct: 510 ENG---NVSQQNGN 520 >At3g62800.2 68416.m07056 double-stranded RNA-binding domain (DsRBD)-containing protein weak similarity to SP|P19525 Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.1.-) {Homo sapiens}; contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 355 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 87 PKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGS 209 P KG K N +E P + + + E VA++E NP+ DG+ Sbjct: 195 PSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGT 235 >At3g62800.1 68416.m07055 double-stranded RNA-binding domain (DsRBD)-containing protein weak similarity to SP|P19525 Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.1.-) {Homo sapiens}; contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 355 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 87 PKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGS 209 P KG K N +E P + + + E VA++E NP+ DG+ Sbjct: 195 PSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGT 235 >At3g57930.1 68416.m06457 expressed protein Length = 141 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/80 (23%), Positives = 39/80 (48%) Frame = +3 Query: 21 RGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSE 200 RG+ + +++ G EE RK+ + PV+++ +E E+ V ++E + Sbjct: 5 RGKGKRQNATAREDRGSGEEEKIPAFRKRGRPQKPVKDEEEEE---EELVKKTDEEEDKD 61 Query: 201 DGSETNGHIEEEQVPSGRGR 260 D +TNG + ++ + GR Sbjct: 62 D--DTNGSVTSKENVTENGR 79 >At3g01160.1 68416.m00020 expressed protein Length = 380 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENG--KIEETAPKKGRKKN--VEEPPVENKSTDEPSVEDEVA 173 EKK R K D + D++ I+ A K + +EEPP++ K + + ++EVA Sbjct: 156 EKKRARKNKQKDDDSSPDDDDDYNIDRKAVKDDGDDDFFMEEPPLKKKKKEGKTKKEEVA 215 Query: 174 VSEEN 188 E++ Sbjct: 216 AEEKS 220 >At1g17690.1 68414.m02190 expressed protein Length = 754 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 129 ENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 239 E KS E +DE EEN+ S+D S T+G ++ Q Sbjct: 89 EGKSDTEEDEDDEDEDEEENSGSDDLSSTDGEDDKSQ 125 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 29.5 bits (63), Expect = 2.8 Identities = 24/86 (27%), Positives = 33/86 (38%), Gaps = 3/86 (3%) Frame = +3 Query: 12 KTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEP---PVENKSTDEPSVEDEVAVSE 182 K KR K D E GK E A +G EE P E ++ +DE E Sbjct: 274 KRKRQTKKR-DLPSDTEEGKDEGDADSEGTNDPHEEDDAAPEEESDHEKTDTDDEKDEVE 332 Query: 183 ENNPSEDGSETNGHIEEEQVPSGRGR 260 PS+ S + +EE G+ + Sbjct: 333 VEKPSKKKSSSKKTVEESSGSKGKDK 358 >At4g28080.1 68417.m04027 expressed protein Length = 1660 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 54 QDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPS-EDGSETNGHIE 230 Q ++G + E P G + + E + D+ + ED+ AV +E + E+G T G +E Sbjct: 1567 QPQDGLVSEELPGAGSSEE-KSGSEEESNNDKNAGEDDEAVGQETTDTPENGHSTVGEVE 1625 >At3g49990.1 68416.m05466 expressed protein Length = 502 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +3 Query: 39 GDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETN 218 G+++G NG++E + ++ R++ +EP EN P DE+ E N S+ + Sbjct: 213 GESSGVS-NGELEFSVRREVRERESDEPVAENPRV--PRQIDELFDQLELNEYGSDSDGD 269 Query: 219 GHIEEE 236 G+I E+ Sbjct: 270 GYIAED 275 >At2g30690.1 68415.m03742 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593; expression supported by MPSS Length = 788 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +3 Query: 57 DENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIE 230 DE ++E + K N+ + + +S +E S +E V+EE +E+ E NGH E Sbjct: 453 DEENEVEGDS-KPLISNNMSDSLEQEQSGEEESEVNENNVAEEYFSNEEEDEVNGHTE 509 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/71 (22%), Positives = 30/71 (42%) Frame = +3 Query: 18 KRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPS 197 K G+ + + K EE +KG K+ + P E+ +DE DE + + Sbjct: 228 KDGKHKGEKSRDKYREDKEEEDIKQKGDKQRDDRPTKEHLRSDEKLTRDESKKKSKFQDN 287 Query: 198 EDGSETNGHIE 230 + G E + ++ Sbjct: 288 DHGHEPDSELD 298 >At3g49470.1 68416.m05407 nascent polypeptide-associated complex (NAC) domain-containing protein similar to alpha-NAC, non-muscle form [Mus musculus] GI:1666690; contains Pfam profile PF01849: NAC domain Length = 217 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/63 (23%), Positives = 28/63 (44%) Frame = +3 Query: 48 NGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHI 227 +GQ E + A + +K +EP VE+ DE +D+ +++ GS Sbjct: 13 DGQPEQPPVTAIAEELEKKLQTDEPIVEDVKDDEDDDDDDEEEEDDDAQGVSGSSKQSRS 72 Query: 228 EEE 236 E++ Sbjct: 73 EKK 75 >At1g67580.1 68414.m07699 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 752 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +3 Query: 27 RKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDG 206 R AAG+++ DE +EE KK RKK PV+ + + + + E S D Sbjct: 271 RWAAGNSSPTDEVEIVEEVGEKKRRKKPF---PVQGRFRNTSQTPEVGELVREGYRSSDS 327 Query: 207 SETNGH 224 E H Sbjct: 328 DERGHH 333 >At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar to variable surface lipoprotein Vsp422-3 (GI:15384285) [Mycoplasma bovis]; similar to glycine-rich protein atGRP-6, Arabidopsis thaliana, PIR:T49893 Length = 225 Score = 28.7 bits (61), Expect = 4.9 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 2/84 (2%) Frame = +3 Query: 6 EKKTKRGRKAAGDTN-GQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSE 182 +K +K GD +D+ EE P+K + +PP + D+P+ E + V E Sbjct: 133 DKPSKEDNLLKGDKPVEEDKLPAEEEKPPQKDKPAEGHKPPQK----DKPA-EGDKPVEE 187 Query: 183 ENNPSED-GSETNGHIEEEQVPSG 251 + P +D +E + H+EE+ +P G Sbjct: 188 DKPPQKDKPAEGDKHVEED-MPLG 210 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 48 NGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVE 161 N +D++G EET ++ R+ + PP E S + PS E Sbjct: 79 NDKDQSGGEEETTSRRKRRSRWDPPPSE--SINNPSAE 114 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 48 NGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVE 161 N +D++G EET ++ R+ + PP E S + PS E Sbjct: 79 NDKDQSGGEEETTSRRKRRSRWDPPPSE--SINNPSAE 114 >At5g23420.1 68418.m02747 high mobility group (HMG1/2) family protein similar to high mobility group protein 2 HMG2 [Ipomoea nil] GI:1052956; contains Pfam profile PF00505: HMG (high mobility group) box Length = 241 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +3 Query: 57 DENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 236 + N EE ++ + +V++ E K D+ +DEV E N +D E G EEE Sbjct: 180 ESNDADEEEEDEEKQSDDVDD--AEEKQVDD---DDEVEEKEVENTDDDKKEAEGKEEEE 234 Query: 237 Q 239 + Sbjct: 235 E 235 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 3/68 (4%) Frame = +3 Query: 24 GRKAAGDTNGQDENGKIEETAPKKGR---KKNVEEPPVENKSTDEPSVEDEVAVSEENNP 194 G K++ ++ +DE + E+ A K+ KK E+ S DE E EE + Sbjct: 397 GNKSSSSSDSEDEEEEKEQKAEKEEESTSKKRQEQEETATDSDDESDSNSEKDQEEEQSQ 456 Query: 195 SEDGSETN 218 E E++ Sbjct: 457 LEKARESS 464 >At5g10660.1 68418.m01234 calmodulin-binding protein-related contains weak similarity to calmodulin-binding proteins Length = 407 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +3 Query: 57 DENGKIEETAPKKGRKKNVEEPPV-ENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 233 DE+G+ +ET+P + + + E+KST++ E EENN SE+ E ++ Sbjct: 237 DESGEEKETSPVAASTEEQKGELIDEDKSTEQIEEPKEPENIEENN-SEEEEEVKKKSDD 295 Query: 234 EQ 239 E+ Sbjct: 296 EE 297 >At4g29680.1 68417.m04228 type I phosphodiesterase/nucleotide pyrophosphatase family protein similar to SP|P06802 Ectonucleotide pyrophosphatase/phosphodiesterase 1 (Plasma-cell membrane glycoprotein PC-1) [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nucleotide pyrophosphatase (EC 3.6.1.9) {Mus musculus}; contains Pfam profile PF01663: Type I phosphodiesterase / nucleotide pyrophosphatase Length = 496 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 83 CFLYFTILILSICVTGSFPSAFGFLF 6 CF+ FT L+L C+ S SAF FLF Sbjct: 50 CFI-FTSLLLVTCIALSAASAFAFLF 74 >At2g25670.2 68415.m03077 expressed protein Length = 318 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +3 Query: 3 LEKKTKRGRKAAGDTNGQDENGKI----EETAPKKGRKKNVEEPPVENKSTDEPSVEDEV 170 LE+ + G++ D NG+ E + E A KK +KK+ ++ E++ + D V Sbjct: 188 LEESQEAGQEKKEDVNGEGEKKENAAGGESKASKKKKKKDKQKEVKESQEQQANNNADAV 247 Query: 171 AVSEENNPSEDGS 209 + + P+E+ S Sbjct: 248 DEAAGSEPTEEES 260 >At2g25670.1 68415.m03076 expressed protein Length = 318 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +3 Query: 3 LEKKTKRGRKAAGDTNGQDENGKI----EETAPKKGRKKNVEEPPVENKSTDEPSVEDEV 170 LE+ + G++ D NG+ E + E A KK +KK+ ++ E++ + D V Sbjct: 188 LEESQEAGQEKKEDVNGEGEKKENAAGGESKASKKKKKKDKQKEVKESQEQQANNNADAV 247 Query: 171 AVSEENNPSEDGS 209 + + P+E+ S Sbjct: 248 DEAAGSEPTEEES 260 >At1g18950.1 68414.m02358 aminoacyl-tRNA synthetase family contains aminoacyl-transfer RNA synthetases class-II signature 1, PROSITE:PS00179 Length = 766 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/68 (20%), Positives = 33/68 (48%) Frame = +3 Query: 57 DENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 236 DE G + T + ++N +P ++ +EP ++ A + + +++NG ++E Sbjct: 667 DETGNGDFTMGSQDSEENANDPETKSGEEEEPRDVNDNADTTNGKENNQLNKSNGTTDQE 726 Query: 237 QVPSGRGR 260 +V G+ Sbjct: 727 EVEGVVGK 734 >At5g58590.1 68418.m07342 Ran-binding protein 1, putative / RanBP1, putative strong similarity to Ran binding proteins from Arabidopsis thaliana atranbp1a [Arabidopsis thaliana] GI:2058282, atranbp1b [Arabidopsis thaliana] GI:2058284; contains Pfam profile PF00638: RanBP1 domain Length = 219 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIEET-APKKGRKKNVEEPPVENKSTDEPSVEDE 167 K++ +G +AAG EN +EE + +K ++ +EP E+K T + VE+E Sbjct: 163 KESTQGDEAAGLI----ENLSVEENISEEKAKEAEEKEPAKEDKETKKEKVEEE 212 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 126 VENKSTDEPSVEDEVAVSEENNPSEDGSETNGH-IEEEQ 239 +EN S +E E++ +EE P+++ ET +EEE+ Sbjct: 175 IENLSVEENISEEKAKEAEEKEPAKEDKETKKEKVEEEK 213 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 60 ENGKIEETAPKKGRKKNVEEPPVENK 137 ENG + +P+KGR ++ PP E + Sbjct: 256 ENGAVRNRSPRKGRGESRSPPPYEKR 281 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 60 ENGKIEETAPKKGRKKNVEEPPVENK 137 ENG + +P+KGR ++ PP E + Sbjct: 256 ENGAVRNRSPRKGRGESRSPPPYEKR 281 >At5g02390.1 68418.m00162 expressed protein ; expression supported by MPSS Length = 835 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = +3 Query: 72 IEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETN 218 IE+ + KKGR PV++ S ++ S+ EV S++N S +G E N Sbjct: 146 IEDKSKKKGRHHRSCTYPVQSNSKEKDSL-SEVGSSDKN--SSNGDERN 191 >At3g49540.1 68416.m05414 expressed protein Length = 166 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 48 NGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDG 206 +G+ +N + ET + E PVE P+V+ EVA EE++ ++ G Sbjct: 38 SGEKQNQTVAETTETTSVEAK-ETFPVEPTKETTPAVQPEVAAVEESSSADAG 89 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 28.3 bits (60), Expect = 6.5 Identities = 26/100 (26%), Positives = 38/100 (38%), Gaps = 9/100 (9%) Frame = +3 Query: 87 PKKG-RKKNVEEP----PVENKSTDEPSVEDEVAVSEENNPSEDGSET----NGHIEEEQ 239 PKK N+EEP P E+ +PS + E E +NP E E+ + E+ + Sbjct: 420 PKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPK 479 Query: 240 VPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVEDKP 359 + PE + PKQE + KP Sbjct: 480 PKPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPPKP 519 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 28.3 bits (60), Expect = 6.5 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 6/81 (7%) Frame = +3 Query: 96 GRKKNVEEPPVENKSTDEPSVEDEVAVSE---ENNPS---EDGSETNGHIEEEQVPSGRG 257 GRKK + PPV + + P E+ V++S+ +PS +DGS + + PS R Sbjct: 516 GRKKVLPSPPVRRRRSLTPD-EERVSLSQGGRHTSPSHIKQDGSMSPVRGRGKSSPSSRH 574 Query: 258 RXXXXXXXXXXPEPRTGRGRK 320 + P P R R+ Sbjct: 575 QKARSPVRRRSPTPVNRRSRR 595 >At1g76820.1 68414.m08939 expressed protein Length = 266 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 60 ENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNP 194 E K+ T KKG+K+N + + + D+ D+ AV EE P Sbjct: 48 EENKVVITGKKKGKKRN--KKGTQQQQDDDDDFADKFAVEEEVVP 90 >At1g29000.1 68414.m03546 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 287 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/68 (26%), Positives = 29/68 (42%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEE 185 +K+ + +K + ++E K EE K+G KK E T VE + V E Sbjct: 195 KKEEEDKKKKEDEKKKEEEKKKEEENKKKEGEKKKEEVKVEVTTKTITQVVEYKEIVKVE 254 Query: 186 NNPSEDGS 209 +DG+ Sbjct: 255 GQKDKDGN 262 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +3 Query: 63 NGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSE 200 + K EE K+ K +E + K DE E+E EEN E Sbjct: 179 SSKTEEEKKKEEEDKKKKEEEDKKKKEDEKKKEEEKKKEEENKKKE 224 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 28.3 bits (60), Expect = 6.5 Identities = 24/105 (22%), Positives = 42/105 (40%) Frame = +3 Query: 42 DTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNG 221 D + + E K +E ++ K V+ KS+D ED+V +E + + G Sbjct: 66 DDDEEREKRKEKERERRRRDKDRVKRRSERRKSSDS---EDDVEEEDERDKRRVNEKERG 122 Query: 222 HIEEEQVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVEDK 356 H E E+ G+ R + R + ++E E E +K Sbjct: 123 HREHER-DRGKDRKRDREREERKDKEREREKDRERREREREEREK 166 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 30 KAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSE 182 K+ D Q + +EE+ +KG+ K E+ VEN V++ + + E Sbjct: 87 KSVVDEEDQQLSKIVEESLKEKGKSKQFEDDQVENDEQQALMVQESLYMVE 137 >At5g62750.1 68418.m07877 expressed protein predicted proteins, Caenorhabditis elegans Length = 124 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 6 EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDE 149 EKK K+ K D N D+NG EE ++ + K ++ + K+ ++ Sbjct: 25 EKKEKKKDKDKKDKNEDDKNGGGEEGEDQEKKSKKKDKKAKKEKNPED 72 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +3 Query: 15 TKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDE-PSVEDEVAVSEENN 191 +KR ++A D+ +D I + K N ++ + DE S+ED+ SEE++ Sbjct: 5 SKRSKRARLDSESED----ISDQENLKAESDNEDDQLPDGIEDDEVDSMEDDEGESEEDD 60 Query: 192 PSEDGSETNGHIEEE 236 + + G EE+ Sbjct: 61 EGDTEEDDEGDSEED 75 >At5g40450.1 68418.m04905 expressed protein Length = 2910 Score = 27.9 bits (59), Expect = 8.6 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = +3 Query: 69 KIEETAPKKGRKKNVE--EPPVENKSTDEPSVEDEVAVSEENNPSED---GSET 215 K+ ET PK+ + + E + VE++ST + V EVA E + P+E+ G ET Sbjct: 2156 KVGETKPKESQAEGAEKSDDQVEDESTKKTDV--EVAGLENDYPTEEAEHGDET 2207 >At3g14670.1 68416.m01856 hypothetical protein Length = 232 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 111 VEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 251 VEE + + +E S +DE SEE E+ E EEE+ G Sbjct: 68 VEEGEKSDNNEEENSEKDEKEESEEEESEEEEKEEEEKEEEEKEEEG 114 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 27.9 bits (59), Expect = 8.6 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +3 Query: 6 EKKTKRGRKAAGD-TNGQDENGKIEET-APKKGRKKNVEEPPVENKSTDEPSVEDEVAVS 179 EK + G+K D T E + +E P + K+N V++K+ DE E E+A + Sbjct: 523 EKIMETGKKINEDGTRKVQEMIRQQELDEPARSEKENRSRELVKSKTNDEEKKEKEIAGT 582 Query: 180 EENNPSED 203 E D Sbjct: 583 ERKEKESD 590 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 27.9 bits (59), Expect = 8.6 Identities = 22/102 (21%), Positives = 43/102 (42%) Frame = +3 Query: 48 NGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSEDGSETNGHI 227 N +DE + EE +K + ++ + K DE ED+ + ++NN + + Sbjct: 54 NDEDEEEEEEEDEERKDSDEERQKKKKKRKKKDEGLDEDDYLLLQDNNVKFKKRQYK-RL 112 Query: 228 EEEQVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQEIEDEVED 353 ++ Q G G+ + R G R + +I+D + D Sbjct: 113 KKAQREQGNGQGESSDDEF---DSRGGTRRSAEDKIKDRLFD 151 >At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam profiles PF04677: Protein similar to CwfJ N terminus 1, PF04676: Protein similar to CwfJ N terminus 2 Length = 692 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 99 RKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSE 200 ++KNV PVE + VE E SE N E Sbjct: 298 KQKNVSVSPVETRGDHRSDVEQEALPSETNKDDE 331 >At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 146 ISRFIFHRRFLYILLPSFFWCCFLYFTILILSI 48 I+ ++ H F YILLP+F C + F +L+ I Sbjct: 413 ITFWVIHDIFSYILLPNF--CIYFMFYVLVYMI 443 >At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 146 ISRFIFHRRFLYILLPSFFWCCFLYFTILILSI 48 I+ ++ H F YILLP+F C + F +L+ I Sbjct: 413 ITFWVIHDIFSYILLPNF--CIYFMFYVLVYMI 443 >At1g15940.1 68414.m01913 expressed protein similar To androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens] Length = 990 Score = 27.9 bits (59), Expect = 8.6 Identities = 25/103 (24%), Positives = 39/103 (37%), Gaps = 4/103 (3%) Frame = +3 Query: 60 ENGKIEETAPKKGRKKNVEEPPVENKST-DEPSVEDEVAVSEENNPSEDGSETNGHIEEE 236 EN +E T ++ +EP E+K+ +EP+ E E E + E +E EE+ Sbjct: 783 ENHNVE-TKTDGEEQEAAKEPTAESKTNGEEPNAEPETDGKEHKSLKEPNAEPKSDGEEQ 841 Query: 237 QVPSGRGRXXXXXXXXXXPEPRTGRGRKPKQE---IEDEVEDK 356 + RK +E + DEVE K Sbjct: 842 EAAKEPNAELKTDGENQEAAKELTAERKTDEEEHKVADEVEQK 884 >At1g09210.1 68414.m01028 calreticulin 2 (CRT2) identical to SP|Q38858 Calreticulin 2 precursor {Arabidopsis thaliana} Length = 424 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +3 Query: 27 RKAAGDTNGQ--DENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAVSEENNPSE 200 +K A +T G+ D + A KK ++ ++ P E+ + DEP +DE +++ SE Sbjct: 344 KKLADETWGKLKDAEKAAFDEAEKKNEEEESKDAPAESDAEDEPE-DDE---GGDDSDSE 399 Query: 201 DGSETNGHIEEEQ 239 +E ++ E+ Sbjct: 400 SKAEETKSVDSEE 412 >At1g01490.1 68414.m00065 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 177 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/56 (28%), Positives = 22/56 (39%) Frame = +3 Query: 9 KKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENKSTDEPSVEDEVAV 176 KK G + E GK E APKK +K E + D+P + + V Sbjct: 83 KKEGGGEPPKKEGEAPKEEGKKEGEAPKKEEEKKEGGDKKEGEKKDQPQAQPQPVV 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,734,347 Number of Sequences: 28952 Number of extensions: 171893 Number of successful extensions: 1378 Number of sequences better than 10.0: 92 Number of HSP's better than 10.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1304 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1872844800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -