BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A10 (849 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_33603| Best HMM Match : PHD (HMM E-Value=0.00046) 29 4.8 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57835| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 693 GSCKLPVQAFFSLVVSNDHRYSCEDCGNW-HARC 595 G K P A SN C++CG W HA+C Sbjct: 205 GPVKYPCSACTKPTKSNQRAICCDECGQWTHAKC 238 >SB_33603| Best HMM Match : PHD (HMM E-Value=0.00046) Length = 396 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 693 GSCKLPVQAFFSLVVSNDHRYSCEDCGNW-HARC 595 G K P A SN C++CG+W HA+C Sbjct: 97 GPVKHPCGACGKPTKSNQKAICCDECGHWMHAKC 130 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 693 GSCKLPVQAFFSLVVSNDHRYSCEDCGNW-HARC 595 G K P A SN C++CG+W HA+C Sbjct: 97 GPVKHPCGACGKPTKSNQKAICCDECGHWMHAKC 130 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 645 NDHRYSCEDCGNWHARC 595 +D+RY CEDCG ++ C Sbjct: 704 SDYRYLCEDCGKPYSTC 720 >SB_57835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 43 GTSERFARHLPATLLDKILVTYRAAERSR 129 G ER R P LDK++ + RAAE SR Sbjct: 152 GGRERLLRERPVPSLDKVVESLRAAEISR 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,875,472 Number of Sequences: 59808 Number of extensions: 396253 Number of successful extensions: 1201 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -