BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A10 (849 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L25599-1|AAA28053.1| 343|Caenorhabditis elegans Hypothetical pr... 29 5.5 AF002198-8|AAF99931.2| 300|Caenorhabditis elegans Serpentine re... 28 7.3 >L25599-1|AAA28053.1| 343|Caenorhabditis elegans Hypothetical protein F54H12.4 protein. Length = 343 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/55 (25%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = +3 Query: 570 QDNLMQPHGNERASFRSLRKNIGGRWKRLVKKKP--EQEVYTIPPELKPQLKQIY 728 Q+NL Q + N++ + + R+N+ +++ + +K+ +++ YT PP K + +Q++ Sbjct: 68 QENLQQQNDNQKRNVKLERRNL--KYEVIPEKRESYQEKDYTNPPVYKAENEQLF 120 >AF002198-8|AAF99931.2| 300|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 3 protein. Length = 300 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -2 Query: 752 SLLERLINVYLLKLWLELRRDRVNFLFRLF 663 S+ ++NVY +K+ ++ R++ + F +RLF Sbjct: 25 SVYTTVMNVYFIKMTVKTRKNMILFFYRLF 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,922,568 Number of Sequences: 27780 Number of extensions: 287266 Number of successful extensions: 918 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2108493618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -