BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A05 (840 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 29 0.18 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 27 0.71 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 27 0.71 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 25 2.2 AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 25 3.8 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 24 6.6 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 24 6.6 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 24 6.6 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 8.7 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 8.7 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 29.1 bits (62), Expect = 0.18 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +1 Query: 196 TSKSKLSADAKEWYPANYT--SQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDM 369 TS+ S +YP++ SQ +PA P +PSRP++ +Q + P D Sbjct: 355 TSRPVASGPTSHYYPSHIPAGSQPVPAVVN---PQQPSRPTIPAPQQQTPPRQPPATGDR 411 Query: 370 SYSLEEAENMD 402 + + + E +D Sbjct: 412 APAHPDVEQID 422 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 27.1 bits (57), Expect = 0.71 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +1 Query: 205 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNP 351 S+L D + Y P NT Y+ PSV G D NP Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 27.1 bits (57), Expect = 0.71 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +1 Query: 205 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNP 351 S+L D + Y P NT Y+ PSV G D NP Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 25.4 bits (53), Expect = 2.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 244 NYTSQALPAYNTEPAPYRPSRPSVQGRL 327 NY PA EP +RP R QGRL Sbjct: 126 NYDLSMSPALWDEPERFRPERFLQQGRL 153 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 24.6 bits (51), Expect = 3.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 631 PEESVFRECLLERCSVEENKIISGLETSXENMRGFAMXXPXLY 759 P +F C ++C EE + + GLE E + A P Y Sbjct: 60 PGTELFEVCY-QQCIYEELEAVDGLEIRVEKLYALAEGFPADY 101 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 23.8 bits (49), Expect = 6.6 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 265 PAYNTEPAPYRPSRPSVQGRLRQAQDQNP 351 PAY +P Y P R + +L A P Sbjct: 191 PAYYPQPDVYNPDRFAASSKLSGASKNRP 219 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 271 YNTEPAPYRPSRPSVQGR 324 YN PY P+ PS GR Sbjct: 199 YNPNARPYNPNDPSFGGR 216 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 160 AGARVPGCSFATPGLVLL 107 AG R P C + P LVL+ Sbjct: 88 AGLRQPACRYRVPSLVLV 105 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 550 IVNQSIGEANFRYNG 594 + N +IG+ANFR+ G Sbjct: 577 VANTNIGDANFRFCG 591 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.4 bits (48), Expect = 8.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 406 RENIANLITVMCEITFDPGKFDTLCGPLVDSFASTLN 516 R + N + + DPG D L GP+ +F L+ Sbjct: 103 RGELNNPFVALGDFLIDPGVSDPLFGPIFAAFLFQLS 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 877,953 Number of Sequences: 2352 Number of extensions: 18414 Number of successful extensions: 41 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -