BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_A01 (835 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0373 - 13194723-13195847,13196219-13196809 31 1.1 10_08_0849 + 21040043-21040199,21040620-21040678,21040925-210424... 28 8.0 >05_03_0373 - 13194723-13195847,13196219-13196809 Length = 571 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -3 Query: 473 VSEFGGTWFQLRR*WRVETRGVIDFDLRCSAR 378 V+E G + QL+R WR + RG++D D R R Sbjct: 502 VNEAGQRFLQLQREWRSDARGIVDGDGRFKFR 533 >10_08_0849 + 21040043-21040199,21040620-21040678,21040925-21042494, 21042583-21042710,21042793-21043033,21043160-21043710 Length = 901 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +3 Query: 477 LLQQLDSQCKQENIFSNWLEEKVDLPSIFENISEVPERVD 596 L+ +L C ++N+ +LE+++ P +FE + +R+D Sbjct: 754 LVLELSELCAEQNLEVWYLEDELISPCMFEELQNQGDRID 793 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,038,511 Number of Sequences: 37544 Number of extensions: 377842 Number of successful extensions: 849 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2303447664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -