Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP16_T7_P09
         (922 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          22   3.5  
DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            23   9.8  
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    23   9.8  

>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 21.8 bits (44), Expect(2) = 3.5
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -2

Query: 513 PXXXXGGGGGGXG 475
           P    GGGGGG G
Sbjct: 543 PAGVGGGGGGGGG 555



 Score = 21.0 bits (42), Expect(2) = 3.5
 Identities = 13/40 (32%), Positives = 13/40 (32%), Gaps = 1/40 (2%)
 Frame = -2

Query: 498 GGGGGGXGXXFFFFXXPXP-PXXFPPXGKFXXGGGGGVXP 382
           GGGGGG G            P    P        GGG  P
Sbjct: 551 GGGGGGGGGGVIGSGSTTRLPPLHQPFPMLANHAGGGAIP 590


>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 23.4 bits (48), Expect = 9.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 476 PXPPPPPP 499
           P PPPPPP
Sbjct: 583 PAPPPPPP 590


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 23.4 bits (48), Expect = 9.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 476 PXPPPPPP 499
           P PPPPPP
Sbjct: 783 PPPPPPPP 790



 Score = 23.4 bits (48), Expect = 9.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 476 PXPPPPPP 499
           P PPPPPP
Sbjct: 784 PPPPPPPP 791


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 369,338
Number of Sequences: 2352
Number of extensions: 6550
Number of successful extensions: 119
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 100055142
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)