SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP16_T7_H09
         (970 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   3.1  
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    23   4.2  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   7.3  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.4 bits (48), Expect = 3.1
 Identities = 8/15 (53%), Positives = 8/15 (53%)
 Frame = -3

Query: 599 GGXPPPPXXXPPPPP 555
           G    PP   PPPPP
Sbjct: 333 GDSDTPPKPAPPPPP 347



 Score = 22.2 bits (45), Expect = 7.3
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 590 PPPPXXXPPPP 558
           PP P   PPPP
Sbjct: 338 PPKPAPPPPPP 348



 Score = 22.2 bits (45), Expect = 7.3
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 587 PPPXXXPPPPP 555
           PP    PPPPP
Sbjct: 338 PPKPAPPPPPP 348


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 4.2
 Identities = 10/33 (30%), Positives = 11/33 (33%)
 Frame = -1

Query: 661 PPPXXXGXVXXXPXXPXXXCXGXPPPPPXXXPP 563
           PP      +      P   C G P P P   PP
Sbjct: 131 PPRPMGPWISVQEQVPRFRCIGPPTPFPRFIPP 163


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 7.3
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -1

Query: 736 PPPPPXAGG 710
           PPPPP  GG
Sbjct: 376 PPPPPIRGG 384


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,470
Number of Sequences: 438
Number of extensions: 6513
Number of successful extensions: 10
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 31927896
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -