BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP16_FL5_B22
(855 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-2547|AAF55570.1| 1194|Drosophila melanogaster CG14304-P... 29 6.2
>AE014297-2547|AAF55570.1| 1194|Drosophila melanogaster CG14304-PA
protein.
Length = 1194
Score = 29.5 bits (63), Expect = 6.2
Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 2/59 (3%)
Frame = -1
Query: 276 PTYATPLMSPYNARLESSSTGSSFPADSPKP--VPLAVVSLDSR*GHSHHLPWXHQPCG 106
P P+ Y + SS+ G+ A P P +P+ V + + H HH H P G
Sbjct: 65 PAPELPINQQYATKHSSSAGGAQLQAPLPGPGRIPVPVAYMPQQKHHPHHHGPPHPPPG 123
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,491,304
Number of Sequences: 53049
Number of extensions: 840767
Number of successful extensions: 2591
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2416
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2590
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4106450400
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -