Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP15_T7_L05
         (776 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80841-1|AAB37939.1|  477|Caenorhabditis elegans Hypothetical pr...    31   1.2  

>U80841-1|AAB37939.1|  477|Caenorhabditis elegans Hypothetical
           protein C13A10.1 protein.
          Length = 477

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 23/67 (34%), Positives = 27/67 (40%)
 Frame = -2

Query: 748 PTTCKLARSSSVLGCTIVTKWIS*LTKRIYSMFESGAWDVTALSSAVQSQDRGEVEARVA 569
           PT   + R   V GC  V      +  R+   F  GAW  T     +  QD G   A VA
Sbjct: 404 PTRIYVTRQHLVSGCVTVLSTPGYVEYRLSGKFGGGAW--TGDDLMIWYQDMG--GAYVA 459

Query: 568 MFQMSFP 548
            FQ  FP
Sbjct: 460 TFQFKFP 466


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,650,133
Number of Sequences: 27780
Number of extensions: 206683
Number of successful extensions: 636
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 603
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 636
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1872168044
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)