BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP15_FL5_E05
(842 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK125992-1|BAC86381.1| 910|Homo sapiens protein ( Homo sapiens ... 30 9.1
>AK125992-1|BAC86381.1| 910|Homo sapiens protein ( Homo sapiens
cDNA FLJ44004 fis, clone TESTI4023546, weakly similar
to Sialidase (EC 3.2.1.18). ).
Length = 910
Score = 30.3 bits (65), Expect = 9.1
Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 3/63 (4%)
Frame = +2
Query: 296 PRPGRDGASTLQQTPSLDASSALRPFTSRXRFSXMQTGHPTTPCS---LRPF*RGTRELC 466
P+P + S+L P S LRP + + S + P T S L P G LC
Sbjct: 99 PQPPKTQVSSLHLEPPETGVSHLRPEPPKTQVSSLHLEPPETGVSHLYLEPSGTGVSHLC 158
Query: 467 PSP 475
P P
Sbjct: 159 PEP 161
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,719,090
Number of Sequences: 237096
Number of extensions: 2047381
Number of successful extensions: 2628
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2542
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2628
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10649685938
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -