BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP15_FL5_C02
(805 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.82
DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 1.00
AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 7.7
>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
protein.
Length = 1370
Score = 25.0 bits (52), Expect = 0.82
Identities = 8/11 (72%), Positives = 8/11 (72%)
Frame = +1
Query: 700 PPPPPPPXXXG 732
PPPPPPP G
Sbjct: 1355 PPPPPPPPSSG 1365
>DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride
channel protein.
Length = 428
Score = 22.2 bits (45), Expect(2) = 1.00
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +1
Query: 703 PPPPPPXXXG 732
PPPPPP G
Sbjct: 343 PPPPPPSSSG 352
Score = 20.6 bits (41), Expect(2) = 1.00
Identities = 6/7 (85%), Positives = 6/7 (85%)
Frame = +1
Query: 700 PPPPPPP 720
P PPPPP
Sbjct: 341 PAPPPPP 347
>AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly
protein 8 protein.
Length = 416
Score = 21.8 bits (44), Expect = 7.7
Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
Frame = +2
Query: 11 FASQWHYTRLVVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNF-QMETYVYKR 187
FAS YT + S T+ G+ +AL+ +T+ L + L + N+N+ E +V +
Sbjct: 229 FASDPRYTTFTINGESFTLQSGIFGMALS--PLTQNLYYSA-LSSHNLNYVNTEQFVKSQ 285
Query: 188 -RADGTH 205
+A+ H
Sbjct: 286 YQANNVH 292
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 200,468
Number of Sequences: 438
Number of extensions: 4135
Number of successful extensions: 23
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25489170
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -