Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP14_T7_L03
         (779 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U21917-1|AAA73920.1|  271|Anopheles gambiae serine protease prot...    27   0.86 
X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.             23   8.0  

>U21917-1|AAA73920.1|  271|Anopheles gambiae serine protease
           protein.
          Length = 271

 Score = 26.6 bits (56), Expect = 0.86
 Identities = 13/44 (29%), Positives = 20/44 (45%)
 Frame = +2

Query: 431 LNTSRANNHHIKPIEWENLGVAWDXNVHXSXWGVCVAQSNHRKC 562
           L  S  ++ +I+PI      V     V  S WGVC   + ++ C
Sbjct: 142 LQLSLPSSAYIRPIALRTSSVPAGSEVVISGWGVCTKVAPYQTC 185


>X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.
          Length = 1231

 Score = 23.4 bits (48), Expect = 8.0
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 636  GPXFFDFIGPXHKT 595
            G  F DFIG  HKT
Sbjct: 1136 GQGFIDFIGQVHKT 1149


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 708,256
Number of Sequences: 2352
Number of extensions: 12824
Number of successful extensions: 39
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 81497388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)