SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP14_FL5_P02
         (979 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317           31   1.1  

>02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317
          Length = 291

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 19/61 (31%), Positives = 21/61 (34%)
 Frame = -1

Query: 820 WRXXPPXHAXPAXXXGXEPXRAXPXEXSLXPXXPXAGXTXPXPXPXXXPAXEPXAXHXPX 641
           +R  PP    P      +P RA        P  P A    P P P   PA  P A   P 
Sbjct: 109 YRPPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPVLVPPPAPAPRPAPAP-APRVPA 167

Query: 640 R 638
           R
Sbjct: 168 R 168


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,044,987
Number of Sequences: 37544
Number of extensions: 245701
Number of successful extensions: 601
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 565
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 597
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2846681820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -