BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP14_FL5_L06
(859 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BT024224-1|ABC86286.1| 923|Drosophila melanogaster LP13067p pro... 30 4.7
>BT024224-1|ABC86286.1| 923|Drosophila melanogaster LP13067p
protein.
Length = 923
Score = 29.9 bits (64), Expect = 4.7
Identities = 15/44 (34%), Positives = 21/44 (47%)
Frame = +2
Query: 452 SSTFDHPFSTPVLRSYWHRNQIEQCHRAITTERLLHHKRLPRRV 583
SS+ + F+ R WHR E+ R + L+H K RRV
Sbjct: 106 SSSVEDLFANEAERRNWHRKTSEKRRRNARKKNLMHTKEKKRRV 149
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,818,870
Number of Sequences: 53049
Number of extensions: 730436
Number of successful extensions: 2023
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1942
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2023
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4126982652
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -