BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP13_T7_F01
(769 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 1.9
>DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein.
Length = 377
Score = 25.4 bits (53), Expect = 1.9
Identities = 17/65 (26%), Positives = 27/65 (41%)
Frame = -1
Query: 421 GRDDHPNIGASSVQPPKVTMINSQEMQALKNNQTQSQPKKSQRSTEAFPALSATAHSPAA 242
G D G S PP +M NS + + Q Q ++ Q+ + A +A A + A
Sbjct: 10 GEDTTGQTGIDSRSPP-ASMHNSSNHNSAASLIVQQQQQQQQQQQQQVAAAAAAAAAAVA 68
Query: 241 PPQWI 227
Q +
Sbjct: 69 QQQQV 73
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 610,442
Number of Sequences: 2352
Number of extensions: 11539
Number of successful extensions: 21
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79834176
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -