SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP13_T7_E02
         (778 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL009246-7|CAA15840.2|  347|Caenorhabditis elegans Hypothetical ...    28   8.6  

>AL009246-7|CAA15840.2|  347|Caenorhabditis elegans Hypothetical
           protein C47F8.8 protein.
          Length = 347

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 8/65 (12%)
 Frame = +2

Query: 596 GPGSAPHWTDPS--HXTLLTRTYCIFFCQSRNPFRHYCAS*NR-T*TF--KF---ACRWA 751
           GP    H T+ +  H  +++ T C  F +     ++ C + NR T +F  KF   ACR+A
Sbjct: 9   GPCQVCHNTETTRRHFGIISCTACAAFFRRSIGMQYLCTAENRCTISFDRKFFCRACRYA 68

Query: 752 NCLTA 766
           +CL A
Sbjct: 69  SCLKA 73


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,584,049
Number of Sequences: 27780
Number of extensions: 208579
Number of successful extensions: 613
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 580
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 612
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1872168044
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -