SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP13_T7_A09
         (883 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    24   2.1  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                24   2.1  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    22   6.5  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    22   6.5  

>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 9/37 (24%), Positives = 17/37 (45%)
 Frame = +1

Query: 619 AGSVPGVFYGGQNSVDGVSRRSDGSLNELCLYRPPTV 729
           +GS   +  G  N     SR +  +   +  ++PPT+
Sbjct: 603 SGSAENLSSGSNNQTSSASRENTSNTTSMESFKPPTL 639


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -2

Query: 864 GXRLIHGIPSXHP 826
           G RL+HGI S HP
Sbjct: 187 GTRLLHGILSQHP 199


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 42  PSLRVPSFHCT 10
           P +R PSF CT
Sbjct: 113 PGMRAPSFRCT 123


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 42  PSLRVPSFHCT 10
           P +R PSF CT
Sbjct: 113 PGMRAPSFRCT 123


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 247,431
Number of Sequences: 438
Number of extensions: 5406
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28644972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -