SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP13_FL5_P22
         (911 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U46673-4|AAC48152.2| 1535|Caenorhabditis elegans Laminin related...    28   8.1  

>U46673-4|AAC48152.2| 1535|Caenorhabditis elegans Laminin related.
           see also lmb-protein 2 protein.
          Length = 1535

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = +2

Query: 14  GQLRTGTDKGNPD-CLIKTKHCDGPRGC*RNVISAQCSEC 130
           G    GT + N D  L++    DG   C  NVI  QC +C
Sbjct: 876 GCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQC 915


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,107,022
Number of Sequences: 27780
Number of extensions: 418067
Number of successful extensions: 1006
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 940
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1006
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2328783996
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -