Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP13_FL5_P01
         (964 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    24   1.8  
DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           22   7.2  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    22   9.5  

>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 24.2 bits (50), Expect = 1.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 463 PFPNWRRNSAG 431
           P+PNW +N AG
Sbjct: 111 PYPNWAQNKAG 121


>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 22.2 bits (45), Expect = 7.2
 Identities = 11/38 (28%), Positives = 19/38 (50%)
 Frame = -1

Query: 472 EVHPFPNWRRNSAGP*LRPRELGKVFVMSVDDLHFLDS 359
           ++ P+PNW  ++ G       + ++ V   D L  LDS
Sbjct: 227 KLRPYPNWEWHTVGNCDGLTSVFRIQVDECDRLWILDS 264


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 21.8 bits (44), Expect = 9.5
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 335 LNSWIWTNAIEK 370
           +N+W+WT  IE+
Sbjct: 69  VNNWLWTPFIER 80


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 223,796
Number of Sequences: 438
Number of extensions: 4524
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 31686018
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)