SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP13_FL5_G22
         (839 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          23   3.5  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   6.1  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   8.1  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 23.0 bits (47), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 586 DLRADGSDPHFH 551
           ++  DGS PHFH
Sbjct: 621 EISQDGSSPHFH 632


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +1

Query: 601  QDTECARRERTQ 636
            QD +C R+ERTQ
Sbjct: 1646 QDHDCIRQERTQ 1657


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 9/35 (25%), Positives = 22/35 (62%)
 Frame = -3

Query: 150 NFIL*VSENISSPVIMSL*IFILMDWRRLKIIKTE 46
           +F+L VS  I++ V  +  IF+ + W + ++++ +
Sbjct: 230 SFLLYVSGFITTEVAGTYAIFLYISWHQKELVRRD 264


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,383
Number of Sequences: 438
Number of extensions: 4612
Number of successful extensions: 13
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26945694
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -