BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP13_FL5_G22
(839 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.5
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.1
DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 8.1
>AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein.
Length = 652
Score = 23.0 bits (47), Expect = 3.5
Identities = 7/12 (58%), Positives = 9/12 (75%)
Frame = -2
Query: 586 DLRADGSDPHFH 551
++ DGS PHFH
Sbjct: 621 EISQDGSSPHFH 632
>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
protein.
Length = 1770
Score = 22.2 bits (45), Expect = 6.1
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = +1
Query: 601 QDTECARRERTQ 636
QD +C R+ERTQ
Sbjct: 1646 QDHDCIRQERTQ 1657
>DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related
protein STG-1 protein.
Length = 397
Score = 21.8 bits (44), Expect = 8.1
Identities = 9/35 (25%), Positives = 22/35 (62%)
Frame = -3
Query: 150 NFIL*VSENISSPVIMSL*IFILMDWRRLKIIKTE 46
+F+L VS I++ V + IF+ + W + ++++ +
Sbjct: 230 SFLLYVSGFITTEVAGTYAIFLYISWHQKELVRRD 264
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,383
Number of Sequences: 438
Number of extensions: 4612
Number of successful extensions: 13
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26945694
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -