Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP13_FL5_E14
         (871 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF439717-1|AAQ04558.1| 1008|Homo sapiens insulin responsive sequ...    30   9.5  

>AF439717-1|AAQ04558.1| 1008|Homo sapiens insulin responsive
           sequence DNA binding protein-1 protein.
          Length = 1008

 Score = 30.3 bits (65), Expect = 9.5
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 8/73 (10%)
 Frame = +2

Query: 329 ILQVTTT-SDVSIFLPHGKLACFLV-CLLAGARSHRTCSVIGTTSI------KRHDTRTL 484
           ++ VTT+ S  S ++P+GKLA + V  LL G R   +   + +T +        H  R L
Sbjct: 752 VINVTTSQSTKSRYVPNGKLASYTVRDLLPGRRYQLSVIAVQSTELGPQQHQGGHHPRVL 811

Query: 485 SSWPPVTTFPILR 523
            + PP    P LR
Sbjct: 812 KNRPPPARLPELR 824


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,273,132
Number of Sequences: 237096
Number of extensions: 2535934
Number of successful extensions: 7131
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6515
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7127
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11048563978
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)