Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP13_FL5_D08
         (853 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_02_0136 + 8698577-8699400,8699525-8700360,8700520-8701679           31   1.2  

>11_02_0136 + 8698577-8699400,8699525-8700360,8700520-8701679
          Length = 939

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -1

Query: 388 LQKXSRFIKNXRLRTRGPPSIXFDLIKALIPSL--VRVLIACISSRITTVIQVTE*DLRN 215
           + K  +F+ + + +  GPPS  FD+    I SL  +R+ I CI +R    ++VTE  +RN
Sbjct: 811 MPKLQKFLFDIKAQGAGPPSGDFDIGIEHISSLRHLRIGIDCIDAR-PCEVEVTEAAVRN 869


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,882,030
Number of Sequences: 37544
Number of extensions: 344607
Number of successful extensions: 595
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 583
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 595
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2373961368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)