BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP11_FL5_C01
(806 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 4.8
>AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase
protein.
Length = 1222
Score = 24.2 bits (50), Expect = 4.8
Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
Frame = +3
Query: 240 RIEEAREDPSSVSLHRLCRQLSNRPAPTCPLVDERG--NRCFSAQARAGVLAVMLERQFA 413
R EEA E P + + R R L P + R R + +AR G L + +
Sbjct: 1108 RAEEAGEAPPPIPMRR--RGLPPSPRTVRARHERRLYLQRLYRQRAREGTLPTVPHGRNR 1165
Query: 414 PNDSAPSEA 440
+ SAPSEA
Sbjct: 1166 RSRSAPSEA 1174
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 721,131
Number of Sequences: 2352
Number of extensions: 13506
Number of successful extensions: 26
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 85239615
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -