Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP11_FL5_B17
         (776 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase ...    22   7.3  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   9.7  

>AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase
           protein.
          Length = 628

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = -1

Query: 149 STYFTKLVPHPHVGEHYFYFCFTINTSLAGSFRSRRHG 36
           S +F +L     +  +Y++F    +T+L G +    HG
Sbjct: 460 SIHFAQLFADRGMKVYYYFFTQRTSTNLWGEWMGVLHG 497


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -2

Query: 775 PPPXPPXGXPP 743
           PPP  P G PP
Sbjct: 46  PPPGGPPGAPP 56


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,446
Number of Sequences: 438
Number of extensions: 3743
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24396777
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)