Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP10_FL5_N17
         (791 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    27   0.26 
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    26   0.46 
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    26   0.46 
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   2.5  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   2.5  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 26.6 bits (56), Expect = 0.26
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 662  PPPPPPPP 685
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 23.4 bits (48), Expect = 2.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 660  PPPPXPPP 683
            PPPP PPP
Sbjct: 1355 PPPPPPPP 1362


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 25.8 bits (54), Expect = 0.46
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = +3

Query: 3   GXXGPGNPRKHLVGPTWPGTSPTDTNGWPPKLN 101
           G  G   PR  L G T   TS T+T G P K+N
Sbjct: 522 GVIGHRMPRYCLFGNTVNLTSRTETTGEPGKIN 554


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 25.8 bits (54), Expect = 0.46
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = +3

Query: 3   GXXGPGNPRKHLVGPTWPGTSPTDTNGWPPKLN 101
           G  G   PR  L G T   TS T+T G P K+N
Sbjct: 522 GVIGHRMPRYCLFGNTVNLTSRTETTGEPGKIN 554


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 662 PPPPPPPP 685
           P PPPPPP
Sbjct: 341 PAPPPPPP 348


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 662  PPPPPPPP 685
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864



 Score = 22.2 bits (45), Expect = 5.7
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +2

Query: 653  GXXPPPPPPP 682
            G   PPPPPP
Sbjct: 1855 GSPEPPPPPP 1864


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.316    0.147    0.489 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 174,644
Number of Sequences: 438
Number of extensions: 4523
Number of successful extensions: 15
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25003662
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)