SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP09_FL5_C09
         (770 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    25   0.78 
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   5.5  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   5.5  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    22   7.3  
AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    22   7.3  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 25.0 bits (52), Expect = 0.78
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +1

Query: 661  PPPPPPPXXXG 693
            PPPPPPP   G
Sbjct: 1355 PPPPPPPPSSG 1365



 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 664  PPPPPPXXXGG 696
            PPPPPP    G
Sbjct: 1355 PPPPPPPPSSG 1365


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +1

Query: 664 PPPPPPXXXG 693
           PPPPPP   G
Sbjct: 343 PPPPPPSSSG 352



 Score = 21.8 bits (44), Expect = 7.3
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = +1

Query: 661 PPPPPPPXXXGG 696
           P PPPPP    G
Sbjct: 341 PAPPPPPPSSSG 352


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +3

Query: 651  GXXXPPPPPP 680
            G   PPPPPP
Sbjct: 1855 GSPEPPPPPP 1864


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%)
 Frame = +2

Query: 365 AYCGTFHTRCFY*PXPS-XXPGTSSLDCFGP 454
           A  GT    CF  P PS   PG    D FGP
Sbjct: 461 ATVGTTVAPCFEEPLPSLPLPGADD-DLFGP 490


>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +3

Query: 21  FASQWHYTRLVVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNF-QMETYVYKR 197
           FAS   YT   +   S T+  G+  +AL+   +T+ L  +  L + N+N+   E +V  +
Sbjct: 229 FASDPRYTTFTINGESFTLQSGIFGMALS--PLTQNLYYSA-LSSHNLNYVNTEQFVKSQ 285

Query: 198 -RADGTH 215
            +A+  H
Sbjct: 286 YQANNVH 292


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 241,590
Number of Sequences: 438
Number of extensions: 7111
Number of successful extensions: 24
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24154023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -