SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP08_FL5_P17
         (1186 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S...    29   0.96 
SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ...    29   0.96 
SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||...    29   0.96 
SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1...    29   0.96 
SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1...    24   1.1  
SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac...    27   6.7  
SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2...    27   6.7  
SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces...    27   6.7  

>SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein
           Cap1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 551

 Score = 29.5 bits (63), Expect = 0.96
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -2

Query: 954 PPPPPPPPP 928
           PPPPPPPPP
Sbjct: 306 PPPPPPPPP 314



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 956 PPPPPPXPP 930
           PPPPPP PP
Sbjct: 306 PPPPPPPPP 314



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -1

Query: 952 PPPPPXPPP 926
           PPPPP PPP
Sbjct: 306 PPPPPPPPP 314


>SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1420

 Score = 29.5 bits (63), Expect = 0.96
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -2

Query: 954 PPPPPPPPP 928
           PPPPPPPPP
Sbjct: 189 PPPPPPPPP 197



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 956 PPPPPPXPP 930
           PPPPPP PP
Sbjct: 189 PPPPPPPPP 197



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -1

Query: 952 PPPPPXPPP 926
           PPPPP PPP
Sbjct: 189 PPPPPPPPP 197



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -2

Query: 954 PPPPPPPPP 928
           P PPPPPPP
Sbjct: 236 PAPPPPPPP 244


>SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1461

 Score = 29.5 bits (63), Expect = 0.96
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -2

Query: 954 PPPPPPPPP 928
           PPPPPPPPP
Sbjct: 775 PPPPPPPPP 783



 Score = 26.6 bits (56), Expect = 6.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 954 PPPPPPPP 931
           PPPPPPPP
Sbjct: 761 PPPPPPPP 768



 Score = 26.6 bits (56), Expect(2) = 1.0
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 951 PPPPPPPP 928
           PPPPPPPP
Sbjct: 761 PPPPPPPP 768



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 956 PPPPPPXPP 930
           PPPPPP PP
Sbjct: 775 PPPPPPPPP 783



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -1

Query: 952 PPPPPXPPP 926
           PPPPP PPP
Sbjct: 775 PPPPPPPPP 783



 Score = 21.0 bits (42), Expect(2) = 1.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -2

Query: 954 PPPPPP 937
           PPPPPP
Sbjct: 732 PPPPPP 737


>SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1841

 Score = 29.5 bits (63), Expect = 0.96
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -2

Query: 954 PPPPPPPPP 928
           PPPPPPPPP
Sbjct: 945 PPPPPPPPP 953



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 956 PPPPPPXPP 930
           PPPPPP PP
Sbjct: 945 PPPPPPPPP 953



 Score = 26.2 bits (55), Expect = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -1

Query: 952 PPPPPXPPP 926
           PPPPP PPP
Sbjct: 945 PPPPPPPPP 953



 Score = 23.4 bits (48), Expect(2) = 2.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -2

Query: 954 PPPPPPPP 931
           P PPPPPP
Sbjct: 905 PTPPPPPP 912



 Score = 22.6 bits (46), Expect(2) = 2.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -2

Query: 951 PPPPPPPP 928
           PPPPPP P
Sbjct: 907 PPPPPPLP 914


>SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 574

 Score = 23.8 bits (49), Expect(2) = 1.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -2

Query: 954 PPPPPPP 934
           PPPPPPP
Sbjct: 311 PPPPPPP 317



 Score = 23.8 bits (49), Expect(2) = 1.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -2

Query: 948 PPPPPPP 928
           PPPPPPP
Sbjct: 337 PPPPPPP 343


>SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit
           Spp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2363

 Score = 26.6 bits (56), Expect = 6.7
 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 4/31 (12%)
 Frame = +1

Query: 631 GGXXPPPPP----XXKKXPPPPXXFFFXKKK 711
           G   PPPPP       + PPPP   +  K+K
Sbjct: 7   GNPPPPPPPPGFEPPSQPPPPPPPGYVKKRK 37



 Score = 26.6 bits (56), Expect = 6.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 954 PPPPPPPP 931
           PPPPPPPP
Sbjct: 9   PPPPPPPP 16



 Score = 26.6 bits (56), Expect = 6.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 951 PPPPPPPP 928
           PPPPPPPP
Sbjct: 9   PPPPPPPP 16


>SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1217

 Score = 26.6 bits (56), Expect = 6.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 954  PPPPPPPP 931
            PPPPPPPP
Sbjct: 1095 PPPPPPPP 1102



 Score = 26.6 bits (56), Expect = 6.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 951  PPPPPPPP 928
            PPPPPPPP
Sbjct: 1095 PPPPPPPP 1102


>SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 713

 Score = 26.6 bits (56), Expect = 6.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 954 PPPPPPPP 931
           PPPPPPPP
Sbjct: 370 PPPPPPPP 377



 Score = 26.6 bits (56), Expect = 6.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 951 PPPPPPPP 928
           PPPPPPPP
Sbjct: 370 PPPPPPPP 377


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,449,376
Number of Sequences: 5004
Number of extensions: 16820
Number of successful extensions: 371
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 161
length of database: 2,362,478
effective HSP length: 74
effective length of database: 1,992,182
effective search space used: 637498240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -