SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP07_T7_F10
         (831 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK096194-1|BAC04723.1|  138|Homo sapiens protein ( Homo sapiens ...    33   1.7  

>AK096194-1|BAC04723.1|  138|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38875 fis, clone MESAN2013936. ).
          Length = 138

 Score = 32.7 bits (71), Expect = 1.7
 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%)
 Frame = -2

Query: 245 GRVRPRAGPGXCXXX-CCXRXXCSCSFTAYDQLL 147
           G    RA PG C    CC    C+CS T +D LL
Sbjct: 81  GETACRASPGQCYVTSCCLSRHCTCSLTWWDVLL 114


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 58,817,905
Number of Sequences: 237096
Number of extensions: 707907
Number of successful extensions: 820
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 768
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 815
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10426655866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -