SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP07_FL5_H08
         (722 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB8E5.06c |rpl302|rpl3-2, rpl3-b|60S ribosomal protein L3|Sch...    30   0.29 
SPAC17A5.03 |rpl301|rpl3-1, rpl3|60S ribosomal protein L3 |Schiz...    30   0.29 
SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||...    29   0.67 
SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ...    27   2.7  
SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces...    27   2.7  
SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S...    27   3.6  
SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac...    27   3.6  
SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2...    27   3.6  
SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1...    27   3.6  
SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1...    24   3.7  

>SPAPB8E5.06c |rpl302|rpl3-2, rpl3-b|60S ribosomal protein
           L3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 388

 Score = 30.3 bits (65), Expect = 0.29
 Identities = 17/46 (36%), Positives = 20/46 (43%)
 Frame = +2

Query: 44  KILXPRXGFLGFXPXKRAPXXPXEGKGVXQKNPPNPGFLXXFXGXK 181
           K   PR G LGF P KRA     + K   + +   P  L  F G K
Sbjct: 5   KFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYK 50


>SPAC17A5.03 |rpl301|rpl3-1, rpl3|60S ribosomal protein L3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 388

 Score = 30.3 bits (65), Expect = 0.29
 Identities = 17/46 (36%), Positives = 20/46 (43%)
 Frame = +2

Query: 44  KILXPRXGFLGFXPXKRAPXXPXEGKGVXQKNPPNPGFLXXFXGXK 181
           K   PR G LGF P KRA     + K   + +   P  L  F G K
Sbjct: 5   KFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYK 50


>SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1461

 Score = 29.1 bits (62), Expect = 0.67
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +1

Query: 529 GPPPPPPPP 555
           GPPPPPPPP
Sbjct: 760 GPPPPPPPP 768



 Score = 29.1 bits (62), Expect = 0.67
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +1

Query: 529 GPPPPPPPP 555
           GPPPPPPPP
Sbjct: 774 GPPPPPPPP 782



 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 533 PPPPPPPP 556
           PPPPPPPP
Sbjct: 776 PPPPPPPP 783



 Score = 25.4 bits (53), Expect = 8.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 529 GPPPPPPPP 555
           G PPPPPPP
Sbjct: 759 GGPPPPPPP 767


>SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1420

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +3

Query: 528 WXPPPPPPPP 557
           + PPPPPPPP
Sbjct: 187 YNPPPPPPPP 196



 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 532 PPPPPPPP 555
           PPPPPPPP
Sbjct: 190 PPPPPPPP 197


>SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 713

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +3

Query: 528 WXPPPPPPPP 557
           + PPPPPPPP
Sbjct: 368 YSPPPPPPPP 377


>SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein
           Cap1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 551

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 533 PPPPPPPP 556
           PPPPPPPP
Sbjct: 306 PPPPPPPP 313



 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 532 PPPPPPPP 555
           PPPPPPPP
Sbjct: 307 PPPPPPPP 314


>SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit
           Spp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2363

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 532 PPPPPPPP 555
           PPPPPPPP
Sbjct: 9   PPPPPPPP 16



 Score = 25.4 bits (53), Expect = 8.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 529 GPPPPPPPP 555
           G PPPPPPP
Sbjct: 7   GNPPPPPPP 15


>SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1217

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 532  PPPPPPPP 555
            PPPPPPPP
Sbjct: 1095 PPPPPPPP 1102


>SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1841

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 534 PPPPPPPP 557
           PPPPPPPP
Sbjct: 945 PPPPPPPP 952



 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 533 PPPPPPPP 556
           PPPPPPPP
Sbjct: 946 PPPPPPPP 953


>SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 574

 Score = 23.8 bits (49), Expect(2) = 3.7
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 533 PPPPPPP 553
           PPPPPPP
Sbjct: 337 PPPPPPP 343



 Score = 21.0 bits (42), Expect(2) = 3.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 539 PPPPPP 556
           PPPPPP
Sbjct: 361 PPPPPP 366


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,393,428
Number of Sequences: 5004
Number of extensions: 14999
Number of successful extensions: 301
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 339215786
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -