SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP06_T7_B02
         (792 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.          27   0.50 
AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    27   0.88 
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    25   2.7  
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.          25   3.5  
EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.          25   3.5  
AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.           25   3.5  

>CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.
          Length = 659

 Score = 27.5 bits (58), Expect = 0.50
 Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 1/72 (1%)
 Frame = +2

Query: 164 KRRAKHLPRRXXXXXXXXXXXXXXXXXIRYRSARRKSAFAGTRPDDKTGFHLRENPEGR- 340
           +RRA    RR                 +R+R  RRKS   G + DDK G+  R   E R 
Sbjct: 494 RRRAIARARRRRCRPRARRNPPATTRPVRHRPTRRKSTKRG-KKDDK-GYDRRSGKEERS 551

Query: 341 HFGRYTVGGAQE 376
           +  RYT G  ++
Sbjct: 552 NDNRYTNGADRD 563


>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 26.6 bits (56), Expect = 0.88
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +2

Query: 365 GAQEPPCTAPPPDRQSSTGRPRTRHLIVPTGAERELHXR 481
           G + P C +PP  R+S + RP +     PT   + L  R
Sbjct: 265 GGRWPSCRSPPARRRSRSTRPTSWPRSRPTSKPKRLPRR 303


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 25.0 bits (52), Expect = 2.7
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +3

Query: 345 SGDTPWAAHRSHLAPPHHRTDSRVPGAPAPAT**SLRGLSGSFTP 479
           SG+   A  R  +    H+ +  +PG P P      RG  G+F P
Sbjct: 319 SGEKGQAGDRGQVGERGHKGEKGLPGQPGP------RGRDGNFGP 357


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALAGRPVL 112


>EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.
          Length = 160

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 95  GTYRWALTGRPVL 107


>EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 97  GTYRWALTGRPVL 109


>EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 82  GTYRWALTGRPVL 94


>EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 82  GTYRWALTGRPVL 94


>EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 92  GTYRWALTGRPVL 104


>EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 92  GTYRWALTGRPVL 104


>EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 98  GTYRWALTGRPVL 110


>EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 99  GTYRWALTGRPVL 111


>EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 98  GTYRWALTGRPVL 110


>EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 86  GTYRWALTGRPVL 98


>EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 86  GTYRWALTGRPVL 98


>EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 86  GTYRWALTGRPVL 98


>EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.
          Length = 154

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 89  GTYRWALTGRPVL 101


>EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 100 GTYRWALTGRPVL 112


>EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 97  GTYRWALTGRPVL 109


>EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 109 GTYRWALTGRPVL 121


>EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 109 GTYRWALTGRPVL 121


>EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 109 GTYRWALTGRPVL 121


>EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 99  GTYRWALTGRPVL 111


>EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 450 GTIRWRVRGRPVL 412
           GT RW + GRPVL
Sbjct: 82  GTYRWALTGRPVL 94


>AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 3.5
 Identities = 20/67 (29%), Positives = 28/67 (41%)
 Frame = +3

Query: 237 HQTYGTAVRAESPPSPVPVLMIRRDFISGKIPKDVISGDTPWAAHRSHLAPPHHRTDSRV 416
           HQT  T V    PP P+ V +  R   +G       SG +  ++    + P  H T S  
Sbjct: 18  HQTLTTQVHPSQPPVPMLVPIPSRTASTG----SASSGHSGSSSLYDRV-PREHATSSPY 72

Query: 417 PGAPAPA 437
              P+PA
Sbjct: 73  HAPPSPA 79


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 644,235
Number of Sequences: 2352
Number of extensions: 15532
Number of successful extensions: 78
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 76
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 78
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 83160600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -