Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP06_FL5_M11
         (897 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        23   2.9  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        23   2.9  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        23   2.9  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    23   5.0  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    23   5.0  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    23   5.0  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    23   5.0  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    23   5.0  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    23   5.0  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    23   5.0  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    23   5.0  

>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -3

Query: 526 VCVAQSNSQEC*HMKLQ*WVDGLVQGPIQSRD 431
           +CV +  S+EC  MK    V G+    I  RD
Sbjct: 36  ICVPEIYSKECDEMKKDSAVKGIPVSCISGRD 67


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -3

Query: 526 VCVAQSNSQEC*HMKLQ*WVDGLVQGPIQSRD 431
           +CV +  S+EC  MK    V G+    I  RD
Sbjct: 36  ICVPEIYSKECDEMKKDSAVKGIPVSCISGRD 67


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -3

Query: 526 VCVAQSNSQEC*HMKLQ*WVDGLVQGPIQSRD 431
           +CV +  S+EC  MK    V G+    I  RD
Sbjct: 36  ICVPEIYSKECDEMKKDSAVKGIPVSCISGRD 67


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 130 GNFPSRPMGPWVP 142


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 130 GNFPSRPMGPWVP 142


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 130 GNFPSRPMGPWVP 142


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 130 GNFPSRPMGPWVP 142


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 130 GNFPSRPMGPWVP 142


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 130 GNFPSRPMGPWVP 142


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 130 GNFPSRPMGPWVP 142


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 841 GRXPSPHXGPWVP 803
           G  PS   GPWVP
Sbjct: 133 GNFPSRPMGPWVP 145


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 213,367
Number of Sequences: 438
Number of extensions: 4450
Number of successful extensions: 14
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29025360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)