SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP06_FL5_D18
         (784 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    23   3.2  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   3.2  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   7.4  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    21   9.8  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   9.8  

>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 111 PLXFXPXGGXNRVXE*IKFVNIL*QLXLXKXI 16
           PL   P G   R+    +FV++  QL L K I
Sbjct: 453 PLLVAPFGAGRRICPGKRFVDLALQLILAKII 484


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -1

Query: 418  PPPPPPXGG 392
            PPPPPP  G
Sbjct: 1357 PPPPPPSSG 1365


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -3

Query: 419  PPPPPPXGXXXKN 381
            PPPPPP      N
Sbjct: 1859 PPPPPPRNHDQNN 1871


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -1

Query: 418 PPPPPPXGG 392
           PPPPP  GG
Sbjct: 376 PPPPPIRGG 384


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 9/20 (45%), Positives = 9/20 (45%)
 Frame = -3

Query: 455 PXRGXXPXFXXXPPPPPPXG 396
           P RG  P     PPP  P G
Sbjct: 34  PQRGSPPNPSQGPPPGGPPG 53


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,872
Number of Sequences: 438
Number of extensions: 3838
Number of successful extensions: 19
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24639531
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -