Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP05_FL5_L06
         (743 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    27   0.25 
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    24   1.7  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   2.3  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   5.3  
AB083209-1|BAC54133.1|   87|Apis mellifera hypothetical protein ...    21   9.2  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 26.6 bits (56), Expect = 0.25
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -2

Query: 682  PPPPPPPP 659
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 22.6 bits (46), Expect(2) = 0.38
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +1

Query: 508  PPPPPPXXGG 537
            PPPPPP   G
Sbjct: 1356 PPPPPPPSSG 1365



 Score = 21.8 bits (44), Expect = 7.0
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 675  PPPPPPXXXXG 643
            PPPPPP    G
Sbjct: 1355 PPPPPPPPSSG 1365



 Score = 21.4 bits (43), Expect(2) = 0.38
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +1

Query: 496  KKXXPPPPPP 525
            ++  PPPPPP
Sbjct: 1351 RQQQPPPPPP 1360


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +1

Query: 499 KXXPPPPPPXXGG 537
           K  PPPPPP   G
Sbjct: 340 KPAPPPPPPSSSG 352



 Score = 23.4 bits (48), Expect = 2.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -2

Query: 682 PPPPPPPP 659
           P PPPPPP
Sbjct: 341 PAPPPPPP 348



 Score = 21.4 bits (43), Expect = 9.2
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 678 PPPPPPPXXXXG 643
           P PPPPP    G
Sbjct: 341 PAPPPPPPSSSG 352


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 681  PPPPPPPP 658
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 5.3
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 511 PPPPPXXGG 537
           PPPPP  GG
Sbjct: 376 PPPPPIRGG 384


>AB083209-1|BAC54133.1|   87|Apis mellifera hypothetical protein
           protein.
          Length = 87

 Score = 21.4 bits (43), Expect = 9.2
 Identities = 10/36 (27%), Positives = 12/36 (33%)
 Frame = +1

Query: 508 PPPPPPXXGGXXXXXXXXGXXGGXPPPXXKXXFFFF 615
           PP PPP               G  PP      FF++
Sbjct: 52  PPGPPPNNEDSSGVIVGASGYGFVPPNQAFYRFFYY 87


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,890
Number of Sequences: 438
Number of extensions: 5109
Number of successful extensions: 47
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23266665
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)