BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP04_T7_L16
(887 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK092627-1|BAC03928.1| 235|Homo sapiens protein ( Homo sapiens ... 31 7.4
>AK092627-1|BAC03928.1| 235|Homo sapiens protein ( Homo sapiens
cDNA FLJ35308 fis, clone PROST2009909, weakly similar to
ADAM 12 PRECURSOR (EC 3.4.24.-). ).
Length = 235
Score = 30.7 bits (66), Expect = 7.4
Identities = 13/42 (30%), Positives = 18/42 (42%)
Frame = +2
Query: 554 PNGHSCFLCEIVIRPAA*AKVRRLDRSRCLLWRSKQRGWRLQ 679
P G C C +RP + L R C +W + GW+ Q
Sbjct: 145 PGGELCGRCSWKLRPGQRGPLPALCREGCPVWEAAVPGWKAQ 186
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,168,443
Number of Sequences: 237096
Number of extensions: 2720819
Number of successful extensions: 5270
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5069
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5270
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11381686510
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -