BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP04_T7_C13
(777 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 5.5
>AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor
protein.
Length = 501
Score = 22.2 bits (45), Expect = 5.5
Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
Frame = +3
Query: 573 RQIAPPTKNGHAPPPT-ESRKSC*SVNPSG--VRAW*DXRVESIKPQAPLL 716
RQ+ + GH PP + R S S SG VR + +S + Q P+L
Sbjct: 265 RQLNSDVQPGHGSPPVKQHRSSSASTTCSGHTVRCFTGGPRKSHESQCPML 315
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 220,672
Number of Sequences: 438
Number of extensions: 4683
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24396777
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -