Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP04_FL5_P22
         (835 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    22   6.1  
DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.               22   6.1  

>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = -3

Query: 698 KLIAFPVAFHRR---TLHSVTERSVHRRCELTRVRQYGHSVLQ 579
           +L  F V  HR+   T+H  T       CE+  VR  G+ ++Q
Sbjct: 184 ELPQFRVLGHRQRHSTIHLSTGNYSRLACEIQFVRSMGYYLIQ 226


>DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.
          Length = 152

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 283 VLRQCLHNPKNE 248
           ++RQC+ N KNE
Sbjct: 97  IIRQCVDNAKNE 108


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,267
Number of Sequences: 438
Number of extensions: 4556
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26702940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)