Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP04_FL5_P07
         (974 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB113647-1|BAD26751.1| 1475|Homo sapiens RGD, leucine-rich repea...    32   2.8  

>AB113647-1|BAD26751.1| 1475|Homo sapiens RGD, leucine-rich repeat,
           tropomodulin and proline-rich containing protein
           protein.
          Length = 1475

 Score = 32.3 bits (70), Expect = 2.8
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 4/61 (6%)
 Frame = +1

Query: 361 WIDKRLSWNAGXMGLXHXAGVLGTLVEA*RGTAKRGC----NHRRGLRSSXARVSNQRAP 528
           W+  R  W AG  GL   AGV  +L         RGC     H    R+  +R  ++ AP
Sbjct: 432 WMTGRADWRAGRGGLGPPAGVANSLPPQLFAAVSRGCCTSLTHLDASRNVFSRTKSRAAP 491

Query: 529 S 531
           +
Sbjct: 492 A 492


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 110,642,914
Number of Sequences: 237096
Number of extensions: 2193613
Number of successful extensions: 3383
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3241
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3383
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 12991778748
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)