Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP03_T7_H22
         (832 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    23   2.6  
AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.           23   4.6  
AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.           23   4.6  

>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 539 GSRYKSQTSNFTILVKVASKLVLSDIIRKITNIQG 643
           GSR +S TSN +  V ++ KL  SD I      +G
Sbjct: 86  GSRDRSNTSNTSKTVILSDKLESSDDISLFRGPEG 120


>AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.
          Length = 136

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -2

Query: 555 LLYLEPSVPLC 523
           L+YLEPS P C
Sbjct: 77  LVYLEPSPPFC 87


>AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.
          Length = 135

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -2

Query: 555 LLYLEPSVPLC 523
           L+YLEPS P C
Sbjct: 78  LVYLEPSPPFC 88


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,535
Number of Sequences: 438
Number of extensions: 3769
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26581563
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)