SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP03_FL5_H16
         (881 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    22   8.6  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    22   8.6  
AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    22   8.6  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   8.6  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    22   8.6  

>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 804 ENPAPPGXP 830
           ENP PPG P
Sbjct: 330 ENPGPPGVP 338


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 804 ENPAPPGXP 830
           ENP PPG P
Sbjct: 330 ENPGPPGVP 338


>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 11  FASQWHYTRLVVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNF-QMETYVYKR 187
           FAS   YT   +   S T+  G+  +AL+   +T+ L  +  L + N+N+   E +V  +
Sbjct: 229 FASDPRYTTFTINGESFTLQSGIFGMALS--PLTQNLYYSA-LSSHNLNYVNTEQFVKSQ 285

Query: 188 -RADGTH 205
            +A+  H
Sbjct: 286 YQANNVH 292


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 6/30 (20%), Positives = 16/30 (53%)
 Frame = +2

Query: 434 VLDPAQDHQPITEASYVNIPVIALCNTDSP 523
           ++DP ++++   E   + IP++   +   P
Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 804 ENPAPPGXP 830
           ENP PPG P
Sbjct: 269 ENPGPPGVP 277


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 252,449
Number of Sequences: 438
Number of extensions: 5904
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28644972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -