BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BmNP02_FL5_M14
(853 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 1.9
>SPAC637.08 |||iron-sulfur cluster assembly ATPase
Nbp35|Schizosaccharomyces pombe|chr 1|||Manual
Length = 317
Score = 27.9 bits (59), Expect = 1.9
Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
Frame = +2
Query: 398 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 532
Y+C + +S G L SED ++ W K GLI+ F + E+ Y
Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,410,678
Number of Sequences: 5004
Number of extensions: 70355
Number of successful extensions: 154
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 147
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 154
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 422462090
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -