BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_P06 (923 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 30 2.5 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 30 2.5 At2g38570.1 68415.m04738 expressed protein ; expression supporte... 29 4.4 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/78 (28%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = -3 Query: 522 EPSHRSRWKLHTRPSRPNGKPSTS-PKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKG 346 + H K H +R + K S K +H SS + H+HR SS+ Sbjct: 651 DKKHSCSRKRHKHKTRYSSKDRHSRDKHKHESSSDDEYHSRSRHRHRHSKSSDRHELYDS 710 Query: 345 STSELTHRHSPLSFSPDL 292 S +E HRH S D+ Sbjct: 711 SDNEGEHRHRSSKHSKDV 728 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/78 (28%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = -3 Query: 522 EPSHRSRWKLHTRPSRPNGKPSTS-PKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKG 346 + H K H +R + K S K +H SS + H+HR SS+ Sbjct: 651 DKKHSCSRKRHKHKTRYSSKDRHSRDKHKHESSSDDEYHSRSRHRHRHSKSSDRHELYDS 710 Query: 345 STSELTHRHSPLSFSPDL 292 S +E HRH S D+ Sbjct: 711 SDNEGEHRHRSSKHSKDV 728 >At2g38570.1 68415.m04738 expressed protein ; expression supported by MPSS Length = 302 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 320 CLWVSSLVEPFVASDGF-DEDGDRCLWCLKAPLMDQED 430 C W+ S PF+ F ++ D + CL + L ++ED Sbjct: 41 CFWIDSKNSPFLGQFSFIEKPRDNFICCLSSSLSNEED 78 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,879,369 Number of Sequences: 28952 Number of extensions: 341867 Number of successful extensions: 960 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2197951248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -