BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_P02 (815 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 31 0.91 At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.6 At1g64340.1 68414.m07291 hypothetical protein 30 2.1 At3g53440.2 68416.m05898 expressed protein 29 2.8 At3g53440.1 68416.m05897 expressed protein 29 2.8 At4g35170.1 68417.m05000 hypothetical protein predicted protein,... 29 3.7 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 29 3.7 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 29 4.9 At2g32590.1 68415.m03979 barren family protein low similarity to... 28 8.5 At1g48600.2 68414.m05434 phosphoethanolamine N-methyltransferase... 28 8.5 At1g48600.1 68414.m05435 phosphoethanolamine N-methyltransferase... 28 8.5 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 31.1 bits (67), Expect = 0.91 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 660 LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFT 553 + C S + + LL P + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -2 Query: 523 TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGL-CLNASKAEA 347 T+V+++ L+ C CD + N +H ++ +K P AGL C +A+ Sbjct: 632 TLVKKMEPDSLVHCTCDCDVRLLHENMDLASDIHRKHQSPIESKDPEAGLDCKERIQADC 691 Query: 346 SLAESGKD 323 S GK+ Sbjct: 692 SPDSGGKE 699 >At1g64340.1 68414.m07291 hypothetical protein Length = 265 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 742 DCESTAYRSFSIKSFSKRCQKSYHQGITGLWQPSVHS 632 DCEST Y SF + SF+++ + + P + S Sbjct: 124 DCESTLYDSFELNSFNRQLNSAISSSARSMSMPHLSS 160 >At3g53440.2 68416.m05898 expressed protein Length = 512 Score = 29.5 bits (63), Expect = 2.8 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +3 Query: 105 RKSSTDYSEPRHRTEVYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHC 284 RKS+ +P R+ L++RD++VK + D +P RR RLV S Sbjct: 4 RKSTVVLPQPIRRSARLISLQNRDSQVKPRKDLGFGSEPTKKTRREVLRGLSKRLVYSSD 63 Query: 285 LEPPDSRGSTVSIS 326 DSR ++IS Sbjct: 64 SPIEDSRSKKLNIS 77 >At3g53440.1 68416.m05897 expressed protein Length = 512 Score = 29.5 bits (63), Expect = 2.8 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +3 Query: 105 RKSSTDYSEPRHRTEVYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHC 284 RKS+ +P R+ L++RD++VK + D +P RR RLV S Sbjct: 4 RKSTVVLPQPIRRSARLISLQNRDSQVKPRKDLGFGSEPTKKTRREVLRGLSKRLVYSSD 63 Query: 285 LEPPDSRGSTVSIS 326 DSR ++IS Sbjct: 64 SPIEDSRSKKLNIS 77 >At4g35170.1 68417.m05000 hypothetical protein predicted protein, Arabidopsis thaliana Length = 163 Score = 29.1 bits (62), Expect = 3.7 Identities = 23/71 (32%), Positives = 33/71 (46%) Frame = +3 Query: 39 QG*VSTVSQHXAALPSTTPRQERKSSTDYSEPRHRTEVYPDLRSRDARVKKKTDSIDLRD 218 QG VS H A S+ PR +YS +V+ DL D R + D ++ Sbjct: 47 QGQVSNFQHHSVAESSSYPRSSGPLRNEYSS----VQVH-DL---DRRTHEDEDYDEMDG 98 Query: 219 PNGLRRRVSRF 251 P+ RRR++RF Sbjct: 99 PDEKRRRITRF 109 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +3 Query: 108 KSSTDYSEPRHRTEVYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 281 K S + +PR R +Y D + + + K+T S+D+ NG + S+ E R+ + H Sbjct: 142 KESQEVIKPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 28.7 bits (61), Expect = 4.9 Identities = 22/74 (29%), Positives = 36/74 (48%) Frame = +3 Query: 99 QERKSSTDYSEPRHRTEVYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKS 278 +E K+S D S+ H E + S A KK+ +S+ +D + +S E +++ Sbjct: 95 EEIKASVDESDLTHMREKSAYV-SALAEAKKREESLK-KDVGIAKECISSLEKTLHEMRA 152 Query: 279 HCLEPPDSRGSTVS 320 C E S GST+S Sbjct: 153 ECAETKVSAGSTMS 166 >At2g32590.1 68415.m03979 barren family protein low similarity to SP|Q9Y7R3 Condensin complex subunit 2 (p105) {Schizosaccharomyces pombe}; contains Pfam profile PF05786: Barren protein Length = 704 Score = 27.9 bits (59), Expect = 8.5 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +3 Query: 81 PSTTPRQERKSSTDYSEPRHRTEVYPDLRSRDARVKKKTDSI-DLRDPNGLRRRVSRFEC 257 P P E KSS + R + + P+L A ++ D ++P L SR C Sbjct: 450 PDVQPASEIKSSPPAKKTRKKKQAEPELDFAKALEEEMPDIFAPPKNPKTLLLPASRTPC 509 Query: 258 ETRLVKSHCLEP 293 +T+L + +P Sbjct: 510 QTKLPEDCHYQP 521 >At1g48600.2 68414.m05434 phosphoethanolamine N-methyltransferase 2, putative (NMT2) very similar to |PEM2_ARATH Putative phosphoethanolamine N-methyltransferase 2 (EC 2.1.1.103) (SP:Q944H0){Arabidopsis thaliana}; very similar to Halotolerance protein Hal3b (SP:P94063)[Arabidopsis thaliana]; to similar to GB:AAF61950 from [Spinacia oleracea] Length = 491 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +3 Query: 102 ERKSS-TDYSEPRHRTEVYPDLRSRDA 179 +RKS+ T Y EPR T+V+ + ++RDA Sbjct: 168 KRKSNPTHYREPRFYTKVFQECQTRDA 194 >At1g48600.1 68414.m05435 phosphoethanolamine N-methyltransferase 2, putative (NMT2) very similar to |PEM2_ARATH Putative phosphoethanolamine N-methyltransferase 2 (EC 2.1.1.103) (SP:Q944H0){Arabidopsis thaliana}; very similar to Halotolerance protein Hal3b (SP:P94063)[Arabidopsis thaliana]; to similar to GB:AAF61950 from [Spinacia oleracea] Length = 475 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +3 Query: 102 ERKSS-TDYSEPRHRTEVYPDLRSRDA 179 +RKS+ T Y EPR T+V+ + ++RDA Sbjct: 152 KRKSNPTHYREPRFYTKVFQECQTRDA 178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,094,427 Number of Sequences: 28952 Number of extensions: 358347 Number of successful extensions: 939 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -