BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_O09 (812 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0351 + 22466160-22466217,22466514-22467052,22467186-224672... 30 1.9 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 29 5.8 02_03_0388 + 18429538-18430598,18430971-18431081,18431165-184312... 29 5.8 05_01_0536 - 4622767-4622865,4623550-4623673,4624571-4624685,462... 28 7.7 01_06_0475 + 29610268-29610711 28 7.7 >09_06_0351 + 22466160-22466217,22466514-22467052,22467186-22467293, 22467391-22467546,22467916-22468131,22468639-22468776, 22468880-22468981,22469089-22469146,22469346-22469408, 22469543-22469640 Length = 511 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -2 Query: 469 ISKYLQSASMRHFDKAARHENPLIVAAGNYIPDPADRMESSRRRPK-HVISDP 314 +S Y +S SM F +AR P++ ++ NY+ RRR + + SDP Sbjct: 53 VSNYSRSTSMERFQLSARFHQPVVDSSTNYLTRWFYNANLKRRRIECFLTSDP 105 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 120 PSKSRASQNLPPXSETRPTEKIR 188 PSKSRASQ PP + TR T+K + Sbjct: 207 PSKSRASQ-APPPAHTRATKKAK 228 >02_03_0388 + 18429538-18430598,18430971-18431081,18431165-18431237, 18431513-18431695 Length = 475 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 96 PDDVANTNPSKSRASQNLPPXSETRPTEKIRRET 197 P PSKSRA Q PP + TR T+K + +T Sbjct: 115 PPQAPRPAPSKSRAPQ-APPPAPTRATKKAKVDT 147 >05_01_0536 - 4622767-4622865,4623550-4623673,4624571-4624685, 4624784-4625028,4625081-4625316 Length = 272 Score = 28.3 bits (60), Expect = 7.7 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 5/70 (7%) Frame = -2 Query: 553 QSRFCRIAV-GAPWFVRNVDLHDDLDLESISKYLQSASMRHFD--KAARHENPLI--VAA 389 +++F ++AV GAP ++R VDL + + LQ HF K E L+ V+ Sbjct: 118 KAKFVKVAVDGAP-YLRKVDLEAYRGYDQLLAALQDKFFSHFTIRKLGNEEMKLVDAVSG 176 Query: 388 GNYIPDPADR 359 Y+P D+ Sbjct: 177 NEYVPTYEDK 186 >01_06_0475 + 29610268-29610711 Length = 147 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 272 SPFSSNPSLATKGSTSKLTLRHSPLSFSPD 183 SP SS+P S+++ TL HSP S SPD Sbjct: 54 SPMSSSPP---SRSSTRATLTHSPSSASPD 80 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,264,680 Number of Sequences: 37544 Number of extensions: 424216 Number of successful extensions: 1161 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1161 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2221181676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -