BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_O08 (783 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4H3.07c |||protein phosphatase Fmp31 |Schizosaccharomyces po... 29 0.99 SPCC18B5.06 |erf1|sup45|translation release factor eRF1|Schizosa... 27 3.0 SPCPB16A4.04c |trm8||tRNA |Schizosaccharomyces pombe|chr 3|||Manual 27 3.0 SPBP4H10.19c |||calreticulin/calnexin homolog|Schizosaccharomyce... 25 9.3 >SPAC4H3.07c |||protein phosphatase Fmp31 |Schizosaccharomyces pombe|chr 1|||Manual Length = 171 Score = 28.7 bits (61), Expect = 0.99 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -3 Query: 163 RWSRASDRLTSSTVRNVINTGITGSWLSWS 74 R + ASD LT +N+ N TGSWL WS Sbjct: 138 RSTTASDILTKLGYKNIGN--YTGSWLEWS 165 >SPCC18B5.06 |erf1|sup45|translation release factor eRF1|Schizosaccharomyces pombe|chr 3|||Manual Length = 390 Score = 27.1 bits (57), Expect = 3.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 154 RASDRLTSSTVRNVINTGITGS 89 + D+L +STVR V+ G TGS Sbjct: 34 QVGDQLKASTVRRVVKVGATGS 55 >SPCPB16A4.04c |trm8||tRNA |Schizosaccharomyces pombe|chr 3|||Manual Length = 273 Score = 27.1 bits (57), Expect = 3.0 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -2 Query: 665 KQLRRFSRVDSTTQRPSVRLFWREHLHASVDGRELRESTRTPTSTKW 525 K+L+R S+ R ++ +R+ HA+V E R+P+ W Sbjct: 21 KKLKRLSKQGGVEGRLPMKRLFRQRAHANVLSDHELEYPRSPSEMDW 67 >SPBP4H10.19c |||calreticulin/calnexin homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 25.4 bits (53), Expect = 9.3 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 735 SSPWSVAEPPPNLIRF-VXNCG 673 S+P +V++ PP++IRF V CG Sbjct: 129 SNPKNVSKEPPSVIRFGVKKCG 150 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,312,332 Number of Sequences: 5004 Number of extensions: 66748 Number of successful extensions: 190 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -