BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_N05 (793 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like pepti... 23 8.2 >AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like peptide 4 precursor protein. Length = 160 Score = 23.4 bits (48), Expect = 8.2 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = -3 Query: 755 VRHLITAXR----SACCTEVCRAHRCYAYCGRFTPG 660 V HL T R CC E C + +YC PG Sbjct: 121 VPHLKTRFRRDVADECCREDCSMAQLLSYCKVVAPG 156 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,724 Number of Sequences: 2352 Number of extensions: 15659 Number of successful extensions: 31 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -