BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_M17 (886 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D55943 Cluster: PREDICTED: similar to Pleckstrin... 36 1.4 UniRef50_A4S5W9 Cluster: Predicted protein; n=2; Ostreococcus|Re... 35 2.4 UniRef50_Q3Y0Z4 Cluster: Putative uncharacterized protein; n=1; ... 34 4.2 >UniRef50_UPI0000D55943 Cluster: PREDICTED: similar to Pleckstrin homology domain-containing family G member 1; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Pleckstrin homology domain-containing family G member 1 - Tribolium castaneum Length = 1421 Score = 35.9 bits (79), Expect = 1.4 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 5/100 (5%) Frame = +3 Query: 21 ESPGAGLSLNRSQHDAALPSTTPRQE---RKSSTDYSEPR--HRTELYPDLRSRDARVKK 185 +SP G N S + + P QE R +S + PR +RT +Y LRS + + + Sbjct: 347 KSPQVGNFANLSPCVQKILANVPDQELSKRFNSEETLGPRRGNRTSIYRSLRSPEKHLNR 406 Query: 186 KTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGS 305 +S+D+ PN +++ +S F ++ S P GS Sbjct: 407 SNESLDIISPN-VQKMISNFPDAELVLPSSERSKPSRNGS 445 >UniRef50_A4S5W9 Cluster: Predicted protein; n=2; Ostreococcus|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 689 Score = 35.1 bits (77), Expect = 2.4 Identities = 27/85 (31%), Positives = 37/85 (43%) Frame = -1 Query: 316 MLTEEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSMLSVFFLTRASRLRRSGYNSV 137 +L PRE ++ R + S+RE RRR P G+R S ++F + R +S Sbjct: 45 LLCFAPRERPEARATRRERRGARSEREARRRKPRGARSSSRALFL---QANFRFLVADSA 101 Query: 136 RCRGSE*SVDDFRSWRGVVLGRAAS 62 R S D SW VV AS Sbjct: 102 DLRASSRDADRMASWEDVVRVDVAS 126 >UniRef50_Q3Y0Z4 Cluster: Putative uncharacterized protein; n=1; Enterococcus faecium DO|Rep: Putative uncharacterized protein - Enterococcus faecium DO Length = 790 Score = 34.3 bits (75), Expect = 4.2 Identities = 27/76 (35%), Positives = 34/76 (44%) Frame = +3 Query: 72 LPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFEC 251 LP T P Q R S SE R DL R+ V+ DSIDL + NG+ + Sbjct: 608 LPKTDPEQYRYKSNINSENEKRIS---DLPKRNQEVQTDDDSIDLPNDNGVEVGTEK-ST 663 Query: 252 ETRLVKSHCLEPPDSR 299 + L K+ L DSR Sbjct: 664 KIGLPKAQNLPMKDSR 679 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 517,407,668 Number of Sequences: 1657284 Number of extensions: 8873636 Number of successful extensions: 26179 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26113 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 79522270534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -