BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_M17 (886 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein... 26 1.3 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 23 9.4 >CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein protein. Length = 271 Score = 26.2 bits (55), Expect = 1.3 Identities = 24/109 (22%), Positives = 45/109 (41%), Gaps = 7/109 (6%) Frame = +3 Query: 45 LNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLR-------SRDARVKKKTDSID 203 L RS +++ ++T ++ + Y + R + DLR D ++ D +D Sbjct: 62 LRRSSRPSSMRASTMKKLNEWLDAYQQERGKGRSMTDLRLAGYGSSEEDENLRAPRDFLD 121 Query: 204 LRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSSVSISLPDSATLASA 350 PN L++ E K EPP+ + V+ P++A+ A Sbjct: 122 AGKPNDLQQEGETLNKEPVETKPQESEPPEMQ--EVTAPKPNTASTNDA 168 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.4 bits (48), Expect = 9.4 Identities = 18/72 (25%), Positives = 27/72 (37%) Frame = -1 Query: 412 GEGGTXEXXYHPAGXCLNAXKAEASVAESGKDMLTEEPRESGGSKQCDFTSRVSHSKRET 233 G GT + A + S A S + EP +GG D R S S+ ++ Sbjct: 353 GAAGTTNSSANSGTGGGTAAPSSGSNANSTAGLNNNEPDTAGGGTVGDGKKRSSRSRSKS 412 Query: 232 RRRSPFGSRRSM 197 +S RS+ Sbjct: 413 LSKSSRSRSRSL 424 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,179 Number of Sequences: 2352 Number of extensions: 8057 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -